Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G28060 132 / 3e-41 Ribosomal protein S24e family protein (.1) AT3G04920 114 / 2e-34 Ribosomal protein S24e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000938 [exp] 133 / 1e-41 AT5G28060 219 / 5e-75 Ribosomal protein S24e family protein (.1) Lus10004123 [exp] 133 / 1e-41 AT5G28060 219 / 5e-75 Ribosomal protein S24e family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G087800 [exp] 136 / 4e-43 AT5G28060 223 / 9e-77 Ribosomal protein S24e family protein (.1) Potri.013G036100 [exp] 135 / 1e-42 AT5G28060 225 / 1e-77 Ribosomal protein S24e family protein (.1) Potri.008G152500 [exp] 132 / 1e-41 AT5G28060 221 / 1e-75 Ribosomal protein S24e family protein (.1) Potri.005G049400 [exp] 132 / 2e-41 AT5G28060 222 / 3e-76 Ribosomal protein S24e family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01282 [flax] [poplar] Ribosomal_S24e Ribosomal protein S24e
Representative CDS sequence Show only first row Show all	>Lus10015941 pacid=23143787 polypeptide=Lus10015941 locus=Lus10015941.g ID=Lus10015941.BGIv1.0 annot-version=v1.0 ATGGCGGAAAGGGAAAACAGTAAGTCCAATGCAGTCAACGTTTACACGCGGAAATTCATGACAAACCGCCTCCTCTCCAGGAAGCAATTCGTCATCGATG TCCACCATCCATCAAAAGCCAATGTCCCCAAGATGGAGTTGAAGGAGAAGTTGGCGGATATGTATGGAGTGAGGGACCCGAACGCAATCTTTGTGTTCAA ATTAAGGACACACATTGGTGGTGGAAAGTCAACTGGGTTTGGATTGATTTATGATTCAGTTGAGAATGCTTAG
AA sequence Show only first row Show all	>Lus10015941 pacid=23143787 polypeptide=Lus10015941 locus=Lus10015941.g ID=Lus10015941.BGIv1.0 annot-version=v1.0 MAERENSKSNAVNVYTRKFMTNRLLSRKQFVIDVHHPSKANVPKMELKEKLADMYGVRDPNAIFVFKLRTHIGGGKSTGFGLIYDSVENA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G28060			Ribosomal protein S24e family ...		Lus10015941 [exp]	0	1
AT5G61330			rRNA processing protein-relate...		Lus10020496 [exp]	1.7	0.9186
AT2G34050			unknown protein		Lus10013954 [exp]	1.7	0.8873
					Lus10028086 [exp]	2.8	0.8638
AT4G08310			unknown protein		Lus10003736 [exp]	3.5	0.8923
AT2G36230		HISN3, APG10	ALBINO AND PALE GREEN 10, Aldo...		Lus10021363 [exp]	6.0	0.8473
AT2G11000		ATMAK10	MAK10 homologue (.1.2)		Lus10005185 [exp]	7.5	0.8714
AT5G05360			unknown protein		Lus10012213 [exp]	9.2	0.8673
AT3G20740		FIE1, FIS3, FIE	FERTILIZATION-INDEPENDENT ENDO...		Lus10011165 [exp]	10.0	0.8428
AT5G25480		AtDNMT2, DNMT2	DNA METHYLTRANSFERASE 2, DNA m...		Lus10026955 [exp]	10.7	0.8471
AT1G03180			unknown protein		Lus10000654 [exp]	10.8	0.8328

Compare expression of checked genes

Lus10015941 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.