Lus10015943 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G04590 284 / 2e-95 EMB2748 unknown protein
AT4G18975 133 / 9e-38 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3), Pentatricopeptide repeat (PPR) superfamily protein (.4)
AT4G21190 131 / 9e-37 EMB1417 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019008 465 / 8e-168 AT1G04590 281 / 5e-93 unknown protein
Lus10028526 126 / 7e-35 AT4G18975 327 / 7e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3), Pentatricopeptide repeat (PPR) superfamily protein (.4)
Lus10027535 116 / 2e-31 AT4G21190 302 / 5e-103 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10039292 110 / 5e-28 AT4G21190 339 / 7e-116 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10009120 71 / 7e-14 AT4G18975 198 / 1e-61 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3), Pentatricopeptide repeat (PPR) superfamily protein (.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G103000 294 / 2e-100 AT1G04590 300 / 9e-101 unknown protein
Potri.006G091500 291 / 1e-99 AT1G04590 272 / 3e-90 unknown protein
Potri.016G102800 164 / 9e-52 AT1G04590 158 / 2e-48 unknown protein
Potri.011G076800 139 / 5e-40 AT4G18975 320 / 2e-110 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3), Pentatricopeptide repeat (PPR) superfamily protein (.4)
Potri.017G148700 133 / 6e-37 AT4G21190 339 / 3e-116 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10015943 pacid=23143769 polypeptide=Lus10015943 locus=Lus10015943.g ID=Lus10015943.BGIv1.0 annot-version=v1.0
ATGATTAATTTCATCATTGACCTTCGCATAATATTTCAGCCAAGATTTGGTCATCAAGCTGCATTCACAAATCTCGACCAAAATGGTGGAAGCACGCAGA
AACGCCAAATAGGGGAGAATATTTCTAGAAAAGAGAGGACTACCTTTCTTGTTCGCACGCTCATGGATCTCAAAGACAGTAAAGAAGGTATTTATGGTGC
TCTTGATGCTTGGGTTGCATGGGAACGAGAATTTCCTATTGGTCCCCTTAAACATGCTTTGCTGGCTCTTGAGAAGGAACAACAATGGCATCGGATAGTT
CAGGTGATTAAATGGATTTTGAGCAAAGGTCAAGGAAACACAATGGGAACATATGGGCAATTGATACGGGCATTGGATAAGGACCACAGGGCAGAAGAAG
CACATATTATTTGGACGAAGAAAGTTGGCAGAGATCTTCATTCTGTGCCTTGGAAGTTATGCAGCATGATGATATCATTATATTATAGAAACAACATGCT
AGAGCGGCTTATAAAGCTTTTCAAGGGAATGGAAGCTTTTGATAGGAAACTTTATGACAAAGTAATAGTGCAGAGGGTAGCAGATGCATATGAGATGTCA
GGGATGCCTGAAGAAAAAGAAAGAGTAGTTGAAAAGTACGCTAATGTATTCACGGTGGCAGAGAAACGATCTGCGAAGAAATCTAGATTGTCCTTGGCAA
CGGAGAAGAAAGACGCTGGACAATGTGAGACTTGA
AA sequence
>Lus10015943 pacid=23143769 polypeptide=Lus10015943 locus=Lus10015943.g ID=Lus10015943.BGIv1.0 annot-version=v1.0
MINFIIDLRIIFQPRFGHQAAFTNLDQNGGSTQKRQIGENISRKERTTFLVRTLMDLKDSKEGIYGALDAWVAWEREFPIGPLKHALLALEKEQQWHRIV
QVIKWILSKGQGNTMGTYGQLIRALDKDHRAEEAHIIWTKKVGRDLHSVPWKLCSMMISLYYRNNMLERLIKLFKGMEAFDRKLYDKVIVQRVADAYEMS
GMPEEKERVVEKYANVFTVAEKRSAKKSRLSLATEKKDAGQCET

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G04590 EMB2748 unknown protein Lus10015943 0 1
AT5G41050 Pollen Ole e 1 allergen and ex... Lus10041541 2.0 0.8621
AT3G55080 SET domain-containing protein ... Lus10040345 2.4 0.8203
AT2G22600 RNA-binding KH domain-containi... Lus10002662 3.2 0.8235
AT1G67590 Remorin family protein (.1.2) Lus10036996 4.6 0.8372
AT2G47640 Small nuclear ribonucleoprotei... Lus10030367 5.1 0.8528
AT4G18100 Ribosomal protein L32e (.1) Lus10007541 7.5 0.8199
AT2G45490 ATAUR3 ataurora3 (.1) Lus10020580 7.7 0.8273
AT4G01040 Glycosyl hydrolase superfamily... Lus10005946 9.5 0.7851
AT1G01920 SET domain-containing protein ... Lus10016435 10.4 0.7486
AT5G41050 Pollen Ole e 1 allergen and ex... Lus10012553 11.2 0.8022

Lus10015943 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.