Lus10015952 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027146 118 / 1e-31 AT4G23180 451 / 1e-150 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Lus10015094 53 / 1e-08 AT4G23160 432 / 7e-143 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1)
Lus10015091 50 / 7e-08 AT5G54650 556 / 1e-178 FORMIN HOMOLOGY 5, formin homology5 (.1.2)
Lus10015096 49 / 3e-07 AT4G05200 234 / 7e-69 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10031579 49 / 3e-07 AT4G23160 477 / 8e-154 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1)
Lus10031578 48 / 4e-07 AT4G23180 422 / 5e-134 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Lus10015095 48 / 5e-07 AT4G23310 220 / 4e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1)
Lus10031581 47 / 8e-07 AT4G23310 213 / 2e-60 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1)
Lus10031580 47 / 1e-06 AT4G23160 424 / 1e-139 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G120900 54 / 2e-09 AT4G23180 454 / 3e-151 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G024228 47 / 8e-07 AT4G23180 551 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.010G108100 46 / 1e-06 AT2G01660 265 / 2e-88 plasmodesmata-located protein 6 (.1.2)
Potri.004G024101 46 / 1e-06 AT4G23180 531 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G086000 44 / 8e-06 AT5G37660 301 / 1e-102 plasmodesmata-located protein 7 (.1.2)
Potri.007G120700 44 / 1e-05 AT3G22060 275 / 2e-93 Receptor-like protein kinase-related family protein (.1)
Potri.007G120500 44 / 1e-05 AT3G22060 278 / 6e-95 Receptor-like protein kinase-related family protein (.1)
Potri.007G120800 43 / 1e-05 AT4G23170 85 / 7e-20 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 9, receptor-like protein kinase-related family protein (.1)
Potri.008G133500 43 / 2e-05 AT2G01660 332 / 1e-114 plasmodesmata-located protein 6 (.1.2)
Potri.007G120401 43 / 2e-05 AT3G22060 271 / 3e-92 Receptor-like protein kinase-related family protein (.1)
PFAM info
Representative CDS sequence
>Lus10015952 pacid=23169804 polypeptide=Lus10015952 locus=Lus10015952.g ID=Lus10015952.BGIv1.0 annot-version=v1.0
ATGGTTGAAAAATGGGTTTCTTTAATTCTTGCACTCGTGTATCTCAGCAAATCTCTCATACCATTCCTCCCTCTGCAAAAGATGTACACTTTGATCATGC
TTCTAGCTCTGTTGCTGCTTCATTTTTGCTACCTTGTTACTGCTAAAACAGATCCCTTTGTATTCTGTGGCACAAACGGAAACTACACCTCAGGAAGTCC
CTACCAGCAGAACTTGAACCTGACCTTGAGCTCGCTCGCTGCGAATGCTTCGGTTACAGGTAACCACACTACTTCGAAAGGATCGAGTCCGGATACTGTC
TATGACCTCATTCAGTGCAGAGCTTATCTATCTAAACAAGACTGTCAAACTTGTGCAGACAAGCATTGCTCTAGGGACAACAAACCACGCGGGAGAAACA
CTTGA
AA sequence
>Lus10015952 pacid=23169804 polypeptide=Lus10015952 locus=Lus10015952.g ID=Lus10015952.BGIv1.0 annot-version=v1.0
MVEKWVSLILALVYLSKSLIPFLPLQKMYTLIMLLALLLLHFCYLVTAKTDPFVFCGTNGNYTSGSPYQQNLNLTLSSLAANASVTGNHTTSKGSSPDTV
YDLIQCRAYLSKQDCQTCADKHCSRDNKPRGRNT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G37660 PDLP7 plasmodesmata-located protein ... Lus10015952 0 1
AT2G39220 PLP6, PLAIIB ,P... PATATIN-like protein 6 (.1) Lus10024533 1.0 1.0000
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10022473 6.3 1.0000
AT1G24260 MADS AGL9, SEP3 SEPALLATA3, AGAMOUS-like 9, K-... Lus10037040 7.1 1.0000
AT4G10950 SGNH hydrolase-type esterase s... Lus10023070 7.7 1.0000
AT1G34575 FAD-binding Berberine family p... Lus10023373 8.9 1.0000
AT1G24260 MADS AGL9, SEP3 SEPALLATA3, AGAMOUS-like 9, K-... Lus10003125 9.0 1.0000
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10000558 10.0 1.0000
AT3G51590 LTP12 lipid transfer protein 12 (.1) Lus10004067 11.0 1.0000
AT3G18960 B3 AP2/B3-like transcriptional fa... Lus10027943 11.1 0.9843
AT1G17930 Aminotransferase-like, plant m... Lus10005482 11.8 1.0000

Lus10015952 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.