Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29280 41 / 3e-06 LCR22 low-molecular-weight cysteine-rich 22 (.1) AT4G29283 39 / 3e-05 LCR21 low-molecular-weight cysteine-rich 21 (.1) AT2G28405 37 / 0.0001 LCR32 low-molecular-weight cysteine-rich 32 (.1) AT4G09795 36 / 0.0002 LCR13 low-molecular-weight cysteine-rich 13 (.1) AT5G48905 35 / 0.0005 LCR12 low-molecular-weight cysteine-rich 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025663 [exp] 77 / 3e-20 AT4G29283 44 / 2e-07 low-molecular-weight cysteine-rich 21 (.1) Lus10015984 [exp] 69 / 4e-17 AT4G29280 47 / 1e-08 low-molecular-weight cysteine-rich 22 (.1) Lus10014354 [exp] 36 / 0.0003 AT2G25344 49 / 3e-09 low-molecular-weight cysteine-rich 14 (.1) Lus10014355 [exp] 36 / 0.0003 AT2G25344 49 / 2e-09 low-molecular-weight cysteine-rich 14 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G180750 [exp] 51 / 5e-10 AT4G29280 54 / 4e-11 low-molecular-weight cysteine-rich 22 (.1) Potri.006G195532 [exp] 50 / 1e-09 AT4G29280 46 / 5e-08 low-molecular-weight cysteine-rich 22 (.1) Potri.001G401800 [exp] 39 / 3e-05 AT4G09153 43 / 5e-07 low-molecular-weight cysteine-rich 36 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0054 [flax] [poplar] Knottin_1 PF07333 [flax] [poplar] SLR1-BP S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP)
Representative CDS sequence Show only first row Show all	>Lus10015983 pacid=23154431 polypeptide=Lus10015983 locus=Lus10015983.g ID=Lus10015983.BGIv1.0 annot-version=v1.0 ATGGCAAAATTCTCTTTTCTCCACGTTCTCACGATCGCATTGATCTTTTCAGGGATGGTACTGGTGTCAGAAGCGAGGGTGGCTTCCGACGACGTACAGA AATGCATAGAGACTTTGTATCCGTCGAAATGCACAGAGGCCGATTGCAAGCAGAAGTGCTTGAATAAGTACCATGACAACAGAAGCTATTGCGTTAAGAA CTTGGGAGGGACTGATGCATCATGTGTCTGTATCTGGAATTGTGGATTGAACTAG
AA sequence Show only first row Show all	>Lus10015983 pacid=23154431 polypeptide=Lus10015983 locus=Lus10015983.g ID=Lus10015983.BGIv1.0 annot-version=v1.0 MAKFSFLHVLTIALIFSGMVLVSEARVASDDVQKCIETLYPSKCTEADCKQKCLNKYHDNRSYCVKNLGGTDASCVCIWNCGLN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G29280		LCR22	low-molecular-weight cysteine-...		Lus10015983 [exp]	0	1
AT5G18460			Protein of Unknown Function (D...		Lus10006860 [exp]	1.0	1.0000
AT2G29110		ATGLR2.8	glutamate receptor 2.8 (.1)		Lus10026877 [exp]	1.4	1.0000
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10029390 [exp]	4.2	1.0000
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10029913 [exp]	4.9	1.0000
					Lus10000400 [exp]	5.5	1.0000
					Lus10009372 [exp]	6.0	1.0000
AT5G19580			glyoxal oxidase-related protei...		Lus10043230 [exp]	6.7	0.9620
AT3G45600		TET3	tetraspanin3 (.1)		Lus10023218 [exp]	7.0	0.9926
AT5G63810		BGAL10	beta-galactosidase 10 (.1)		Lus10023977 [exp]	8.0	0.9889
AT4G25480	AP2_ERF	CBF3, DREB1A, A...	C-REPEAT BINDING FACTOR 3, de...		Lus10024491 [exp]	8.2	0.8963

Compare expression of checked genes

Lus10015983 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.