Gene [FLAX] | FIBexDB

Lus10015984 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	Alias	TAIR10 short description
AT4G29280	48 / 7e-09	LCR22	low-molecular-weight cysteine-rich 22 (.1)
AT4G29273	43 / 5e-07	LCR23	low-molecular-weight cysteine-rich 23 (.1)
AT4G09795	42 / 9e-07	LCR13	low-molecular-weight cysteine-rich 13 (.1)
AT4G29283	38 / 6e-05	LCR21	low-molecular-weight cysteine-rich 21 (.1)
AT5G48905	37 / 8e-05	LCR12	low-molecular-weight cysteine-rich 12 (.1)
AT4G29305	35 / 0.0005	LCR25	low-molecular-weight cysteine-rich 25 (.1)
AT4G09153	35 / 0.0009	LCR36	low-molecular-weight cysteine-rich 36 (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10015983 [exp]	69 / 4e-17	AT4G29280	41 / 3e-06	low-molecular-weight cysteine-rich 22 (.1)
Lus10025663 [exp]	48 / 5e-09	AT4G29283	44 / 2e-07	low-molecular-weight cysteine-rich 21 (.1)
Lus10021078 [exp]	40 / 1e-05	AT5G48905	43 / 6e-07	low-molecular-weight cysteine-rich 12 (.1)
Lus10017233 [exp]	38 / 5e-05	AT5G48905	42 / 1e-06	low-molecular-weight cysteine-rich 12 (.1)
Lus10017432 [exp]	36 / 0.0003	AT4G29305	39 / 3e-05	low-molecular-weight cysteine-rich 25 (.1)

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.001G180750 [exp]	87 / 2e-24	AT4G29280	54 / 4e-11	low-molecular-weight cysteine-rich 22 (.1)
Potri.006G195532 [exp]	81 / 1e-21	AT4G29280	46 / 5e-08	low-molecular-weight cysteine-rich 22 (.1)
Potri.001G401800 [exp]	40 / 6e-06	AT4G09153	43 / 5e-07	low-molecular-weight cysteine-rich 36 (.1)

PFAM info

Clan ID	Clan name	Pfam ID	Pfam name	Pfam description
CL0054 [flax] [poplar]	Knottin_1	PF07333 [flax] [poplar]	SLR1-BP	S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP)

Representative CDS sequence

Show only first row Show all

>Lus10015984 pacid=23154440 polypeptide=Lus10015984 locus=Lus10015984.g ID=Lus10015984.BGIv1.0 annot-version=v1.0

ATGGCGAAATCTTCCTTCCTCCAAATCTTCATTGCCCTCTTGATTGTTTCAGCTACGATGCAAATCCAAGAAACAAACGCGCAAAAGAGGTGCGTGGAGA

CGTTATACCCGACAGGATGTACGCTGCTGGATTGCGGGCAGAAGTGCTGGGCGAAACATCAATCGACGGGACGCCAATGCATTCCCAACCAAGCTATGAC

GAGCTACGCTTGTGTCTGTGCTTGGAATTGTTGA

AA sequence

Show only first row Show all

>Lus10015984 pacid=23154440 polypeptide=Lus10015984 locus=Lus10015984.g ID=Lus10015984.BGIv1.0 annot-version=v1.0

MAKSSFLQIFIALLIVSATMQIQETNAQKRCVETLYPTGCTLLDCGQKCWAKHQSTGRQCIPNQAMTSYACVCAWNC

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G29280		LCR22	low-molecular-weight cysteine-...		Lus10015984 [exp]	0	1

Lus10015984 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.