Lus10015993 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G06530 63 / 3e-12 AtABCG22, ABCG22 Arabidopsis thaliana ATP-binding cassette G22, ATP-binding cassette G22, ABC-2 type transporter family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G199500 81 / 1e-18 AT5G06530 1013 / 0.0 Arabidopsis thaliana ATP-binding cassette G22, ATP-binding cassette G22, ABC-2 type transporter family protein (.1.2.3)
Potri.016G065900 77 / 5e-17 AT5G06530 1139 / 0.0 Arabidopsis thaliana ATP-binding cassette G22, ATP-binding cassette G22, ABC-2 type transporter family protein (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10015993 pacid=23154457 polypeptide=Lus10015993 locus=Lus10015993.g ID=Lus10015993.BGIv1.0 annot-version=v1.0
ATGGAGAAGGCGGCGAGTAGCTTGTCCGAGCTGGTGAGGACGAAGTCGGAGCAGCTGGTGGAGACGGTGACTGAGGCATTCAAGTCGCCGCCGCCACTGC
CTCCGGCGGATCCCGGCTCGGCAATGTCTTCGGAGGTAGCCGGAAGCGGGACTTCGACGAGGAAGTCGAGCAGGAGGATGACGGCGCCGTCGCCGGGTAG
GAGCGGCGGTGGGAGGAGCAACACGCACATAAGGAAGTCACGTAGCGCGCAGATGAAGTTCGAGCTCGACGAGATGATTAACAGCGGTGCGGCTCTAAGC
CGAGCTTCAAGCGCCAGCTTGGGACTGTCGTTTTCCTTCACCGGGTTCAACATGCCGCCGGAGGAGATGGCCGACTCTAAGCCCTTTAGCGACGACGATA
TCCTTCCGAGACTTGTGGAGTCAAACAATTTTTCGTCTTACGATGGTTAA
AA sequence
>Lus10015993 pacid=23154457 polypeptide=Lus10015993 locus=Lus10015993.g ID=Lus10015993.BGIv1.0 annot-version=v1.0
MEKAASSLSELVRTKSEQLVETVTEAFKSPPPLPPADPGSAMSSEVAGSGTSTRKSSRRMTAPSPGRSGGGRSNTHIRKSRSAQMKFELDEMINSGAALS
RASSASLGLSFSFTGFNMPPEEMADSKPFSDDDILPRLVESNNFSSYDG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G06530 AtABCG22, ABCG2... Arabidopsis thaliana ATP-bindi... Lus10015993 0 1
AT5G06530 AtABCG22, ABCG2... Arabidopsis thaliana ATP-bindi... Lus10015994 1.0 0.9091
AT1G02520 MDR8, ABCB11, P... multi-drug resistance 8, ATP-b... Lus10010012 3.2 0.8879
AT3G22840 ELIP1 EARLY LIGHT-INDUCABLE PROTEIN,... Lus10039378 5.2 0.8779
AT3G47570 Leucine-rich repeat protein ki... Lus10040186 6.0 0.8759
AT5G24320 Transducin/WD40 repeat-like su... Lus10032436 7.4 0.8550
Lus10029619 8.8 0.8128
AT3G49220 Plant invertase/pectin methyle... Lus10022412 8.9 0.8405
AT1G70260 nodulin MtN21 /EamA-like trans... Lus10010696 10.3 0.7974
AT5G59310 LTP4 lipid transfer protein 4 (.1) Lus10015278 12.7 0.8634
AT4G39490 CYP96A10 "cytochrome P450, family 96, s... Lus10018162 14.9 0.8697

Lus10015993 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.