Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76200 91 / 4e-26 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012279 [exp] 106 / 1e-30 AT1G76200 79 / 1e-19 unknown protein Lus10034571 [exp] 101 / 2e-30 AT1G76200 94 / 2e-27 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G012700 [exp] 105 / 5e-32 AT1G76200 91 / 2e-26 unknown protein Potri.005G248600 [exp] 102 / 1e-30 AT1G76200 91 / 3e-26 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016001 pacid=23154436 polypeptide=Lus10016001 locus=Lus10016001.g ID=Lus10016001.BGIv1.0 annot-version=v1.0 ATGGCGGGAGGGCATGGAGGTGAATTCACTTTCAACGGAGTCACCCTGCATAAACCGAAGCGGTGGCATACTGTCACCGGGAAGGGTCTTTGCGCCGTCA TGTGGTTCTGGGTTCTTTACAGGGCTAAGCAGGACGGTCCTGTTGTGTTGGGATGGAGACATCCATGGGACGGTCATGGTGATGATCATGGTAATGGGCA CTAG
AA sequence Show only first row Show all	>Lus10016001 pacid=23154436 polypeptide=Lus10016001 locus=Lus10016001.g ID=Lus10016001.BGIv1.0 annot-version=v1.0 MAGGHGGEFTFNGVTLHKPKRWHTVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWDGHGDDHGNGH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G76200			unknown protein		Lus10016001 [exp]	0	1
AT3G03100			NADH:ubiquinone oxidoreductase...		Lus10030358 [exp]	4.7	0.8675
AT1G56423			unknown protein		Lus10020695 [exp]	4.9	0.8613
AT5G57860			Ubiquitin-like superfamily pro...		Lus10036598 [exp]	4.9	0.8439
AT2G04900			unknown protein		Lus10001166 [exp]	6.3	0.8520
AT3G59470	FAR1_related		Far-red impaired responsive (F...		Lus10026854 [exp]	7.2	0.8433
AT4G17010			unknown protein		Lus10006582 [exp]	8.0	0.8379
AT3G58680		MBF1B, ATMBF1B	multiprotein bridging factor 1...		Lus10017945 [exp]	9.6	0.8236
AT1G26940			Cyclophilin-like peptidyl-prol...		Lus10037197 [exp]	11.2	0.8372
AT3G03490		AtPEX19-1, PEX1...	peroxin 19-1 (.1)		Lus10010463 [exp]	12.2	0.8087
AT5G67590		FRO1	FROSTBITE1, NADH-ubiquinone ox...		Lus10011547 [exp]	13.1	0.8549

Compare expression of checked genes

Lus10016001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.