Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042745 [exp] 37 / 0.0002 AT2G23110 82 / 3e-22 Late embryogenesis abundant protein, group 6 (.1.2) Lus10029709 [exp] 35 / 0.0004 AT2G23110 79 / 1e-20 Late embryogenesis abundant protein, group 6 (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10714 [flax] [poplar] LEA_6 Late embryogenesis abundant protein 18
Representative CDS sequence Show only first row Show all	>Lus10016041 pacid=23154374 polypeptide=Lus10016041 locus=Lus10016041.g ID=Lus10016041.BGIv1.0 annot-version=v1.0 ATGTACAGAGACAAGGAAGCTGCTGCTGCTGCTGCATCTGTCACTGGTAGCAACAAAGAAGAAGTAAAGCTGCCAATGGAGAGCAGTCCTTACACAAACT ACTCCAATTTGGATGAGTACAAAACTGAAAGGGTATGGAGCCCAAGGCCACCAATCTGTCAACCCGAACCAAACTCATACGGCCTCCACTGA
AA sequence Show only first row Show all	>Lus10016041 pacid=23154374 polypeptide=Lus10016041 locus=Lus10016041.g ID=Lus10016041.BGIv1.0 annot-version=v1.0 MYRDKEAAAAAASVTGSNKEEVKLPMESSPYTNYSNLDEYKTERVWSPRPPICQPEPNSYGLH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10016041 [exp]	0	1
AT4G18770	MYB	ATMYB98	myb domain protein 98 (.1)		Lus10042111 [exp]	2.2	0.9444
AT1G06460		ACD31.2, ACD32....	ALPHA-CRYSTALLIN DOMAIN 31.2, ...		Lus10007366 [exp]	6.9	0.9251
AT2G30900		TBL43	TRICHOME BIREFRINGENCE-LIKE 43...		Lus10007367 [exp]	6.9	0.9284
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10022114 [exp]	7.1	0.9342
AT3G24420			alpha/beta-Hydrolases superfam...		Lus10017735 [exp]	7.1	0.9304
AT4G29035			Plant self-incompatibility pro...		Lus10022825 [exp]	8.9	0.9281
					Lus10038154 [exp]	10.4	0.9175
AT4G33040			Thioredoxin superfamily protei...		Lus10024982 [exp]	11.0	0.9211
					Lus10017869 [exp]	12.1	0.9217
AT1G71890		SUC5, ATSUC5	SUCROSE-PROTON SYMPORTER 5, Ma...		Lus10028616 [exp]	13.0	0.8984

Compare expression of checked genes

Lus10016041 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.