Lus10016055 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G66410 310 / 8e-108 PLP3B phosducin-like protein 3 homolog (.1)
AT3G50960 298 / 2e-103 PLP3A phosducin-like protein 3 homolog (.1)
AT2G18990 130 / 2e-37 TXND9 thioredoxin domain-containing protein 9 homolog (.1)
AT3G25580 127 / 1e-36 Thioredoxin superfamily protein (.1)
AT1G69880 41 / 0.0002 ATH8 thioredoxin H-type 8 (.1)
AT5G14240 41 / 0.0003 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025176 375 / 8e-134 AT5G66410 362 / 1e-128 phosducin-like protein 3 homolog (.1)
Lus10013889 118 / 2e-33 AT3G25580 255 / 1e-87 Thioredoxin superfamily protein (.1)
Lus10026602 77 / 4e-18 AT3G25580 168 / 3e-54 Thioredoxin superfamily protein (.1)
Lus10018383 39 / 0.0008 AT1G11530 145 / 3e-46 C-terminal cysteine residue is changed to a serine 1 (.1)
Lus10007630 39 / 0.0008 AT1G11530 143 / 4e-45 C-terminal cysteine residue is changed to a serine 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G020400 312 / 7e-109 AT5G66410 297 / 8e-103 phosducin-like protein 3 homolog (.1)
Potri.001G297900 120 / 8e-34 AT3G25580 286 / 3e-99 Thioredoxin superfamily protein (.1)
Potri.009G092700 119 / 3e-33 AT2G18990 290 / 2e-100 thioredoxin domain-containing protein 9 homolog (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00085 Thioredoxin Thioredoxin
Representative CDS sequence
>Lus10016055 pacid=23154410 polypeptide=Lus10016055 locus=Lus10016055.g ID=Lus10016055.BGIv1.0 annot-version=v1.0
ATGGATCCAGATGCGGTTAAATCTACTTTGTCCAATCTAGCTTTCGGAAATGTATTGGCGGCAGCTGCTCGCGATTACCAAAAGGAGTTGGTTGCTCAAG
GCAAGGCTCAGTCATCAAGTTCTGCTAACCAAGAAGTAGACCTTGATGAGTTGATGGATGATCCAGAGTTAGAAAAACTACATGCTGACAGAATTGCCGC
ATTGAAGAGAGAAGCTGAGAAACGAGAGTCCCTACAAAGACAAGGACATGGAGAGTACAGGGAGATAACGGAAGGGGATTTCTTAGGCGAAGTCACTAGG
AGTGACAAAGTTATTTGCCACTTTTACCATAAAGAGTTCTACCGGTGCAAGATAGTAGATAAGCATTTGAAGGTTCTTGCTCCAAAGTATTTGGATACCA
AGTTTGTCAGGCTGGATGCTGAGAATGCTCCCTTCTTTGTTGCCAAACTTGGGATCAAAACTCTGCCTTGCGTCATACTCTTTAGGAAAGGGATCGCATC
AGATAGACTGGTTGGCTTCCAGGATCTGGGAGGCAAAGATGATTTCCCAACCAAGAAACTCGAAAACTACTTCTTAAAGAAAGGTATCATTAGTGAGAAG
AAGAGCAACGAGGAAGACGAGGAGGAGTACGATGAAAGCCGTCGAAGGACAGTGAGGTCAACTGCCGAGGCTGATTCTGATTCGGATTAA
AA sequence
>Lus10016055 pacid=23154410 polypeptide=Lus10016055 locus=Lus10016055.g ID=Lus10016055.BGIv1.0 annot-version=v1.0
MDPDAVKSTLSNLAFGNVLAAAARDYQKELVAQGKAQSSSSANQEVDLDELMDDPELEKLHADRIAALKREAEKRESLQRQGHGEYREITEGDFLGEVTR
SDKVICHFYHKEFYRCKIVDKHLKVLAPKYLDTKFVRLDAENAPFFVAKLGIKTLPCVILFRKGIASDRLVGFQDLGGKDDFPTKKLENYFLKKGIISEK
KSNEEDEEEYDESRRRTVRSTAEADSDSD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G66410 PLP3B phosducin-like protein 3 homol... Lus10016055 0 1
AT5G13050 5-FCL 5-formyltetrahydrofolate cyclo... Lus10042162 2.4 0.9000
AT1G23750 Nucleic acid-binding, OB-fold-... Lus10030617 3.9 0.8683
AT5G13050 5-FCL 5-formyltetrahydrofolate cyclo... Lus10004254 4.2 0.8752
AT5G38790 unknown protein Lus10034101 10.8 0.8298
AT1G05010 ACO4, EAT1, EFE ethylene forming enzyme, ethyl... Lus10015153 18.1 0.8569
AT5G23550 Got1/Sft2-like vescicle transp... Lus10029537 19.2 0.7868
AT1G75240 ZF_HD ATHB33, ZHD5 zinc-finger homeodomain 5, hom... Lus10031885 19.2 0.8543
AT2G19880 Nucleotide-diphospho-sugar tra... Lus10012951 20.2 0.8535
AT2G39170 unknown protein Lus10028816 21.5 0.8188
AT2G37195 unknown protein Lus10019937 21.9 0.8494

Lus10016055 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.