Lus10016057 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025178 0 / 1 AT5G03795 471 / 5e-163 Exostosin family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10016057 pacid=23154462 polypeptide=Lus10016057 locus=Lus10016057.g ID=Lus10016057.BGIv1.0 annot-version=v1.0
ATGAGGCTTCCTCACCACTCCCCAACTTCCCCTTCTTCTTCATTTCCAATCTCATTCATCCTCATCACCATTCCACTCCTTCTAATCTCCGCATTCGCCT
TCTTCGCTCTGTCGAATCCACCCACGCTGATCTCCTTCCCTCCTCCTCCTCTAGTTACTCATGACCACTCCCAGCCAGACCTCTCGATCATTAAACCCTC
TTCTTCCAACTCAACTCCCAAACCCACACCACCACCAGCACCGCCGACAGTACTGGTGAAGAGGTACAACAAGCTGGAGAAGGCTGAGGCCAATCTGGCC
AAGGTGAGGTCCTCGATTCGAGCAGCTGCTGCTCGAATCGGGAACCTGACCCTGAAGGACCCGGACTACGTCCCCTGGGGGTGTCATTTACAGGAACGCC
AACGCGTTCCACAAGAGCTACCTTGA
AA sequence
>Lus10016057 pacid=23154462 polypeptide=Lus10016057 locus=Lus10016057.g ID=Lus10016057.BGIv1.0 annot-version=v1.0
MRLPHHSPTSPSSSFPISFILITIPLLLISAFAFFALSNPPTLISFPPPPLVTHDHSQPDLSIIKPSSSNSTPKPTPPPAPPTVLVKRYNKLEKAEANLA
KVRSSIRAAAARIGNLTLKDPDYVPWGCHLQERQRVPQELP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10016057 0 1
AT5G24620 Pathogenesis-related thaumatin... Lus10032914 6.6 0.9146
AT5G16500 Protein kinase superfamily pro... Lus10020383 8.7 0.8790
AT4G18340 Glycosyl hydrolase superfamily... Lus10042825 9.6 0.9072
AT5G24620 Pathogenesis-related thaumatin... Lus10015591 9.7 0.9130
AT5G54160 ATOMT1 O-methyltransferase 1 (.1) Lus10039864 14.7 0.9017
AT5G03795 Exostosin family protein (.1) Lus10016058 15.3 0.8971
AT1G75720 Plant protein of unknown funct... Lus10036971 16.4 0.8973
AT2G30540 Thioredoxin superfamily protei... Lus10040899 21.0 0.8943
AT1G23530 unknown protein Lus10030608 25.8 0.8958
AT4G27960 UBC9 ubiquitin conjugating enzyme 9... Lus10005072 27.0 0.8928

Lus10016057 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.