Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07600 62 / 5e-13 Heavy metal transport/detoxification superfamily protein (.1) AT5G48290 58 / 2e-11 Heavy metal transport/detoxification superfamily protein (.1.2) AT4G05030 57 / 3e-11 Copper transport protein family (.1) AT3G20180 54 / 3e-10 Copper transport protein family (.1) AT1G55790 42 / 2e-05 Domain of unknown function (DUF2431) (.1), Domain of unknown function (DUF2431) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016062 [exp] 123 / 2e-37 AT5G48290 89 / 2e-23 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025181 [exp] 118 / 1e-35 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025180 [exp] 115 / 1e-34 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016061 [exp] 112 / 3e-33 AT5G48290 82 / 1e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025182 [exp] 85 / 5e-22 AT5G48290 62 / 5e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016063 [exp] 82 / 4e-21 AT3G07600 64 / 8e-14 Heavy metal transport/detoxification superfamily protein (.1) Lus10016059 [exp] 78 / 2e-19 AT4G05030 62 / 2e-13 Copper transport protein family (.1) Lus10025179 [exp] 78 / 2e-19 AT4G05030 62 / 1e-13 Copper transport protein family (.1) Lus10014967 [exp] 43 / 1e-05 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G048100 [exp] 81 / 7e-21 AT3G07600 79 / 8e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048400 [exp] 80 / 3e-20 AT3G07600 80 / 3e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048300 [exp] 77 / 4e-19 AT3G07600 80 / 4e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G171300 [exp] 73 / 2e-17 AT3G07600 75 / 5e-18 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G171500 [exp] 71 / 1e-16 AT3G07600 73 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1) Potri.018G023600 [exp] 67 / 4e-14 AT2G20142 86 / 7e-19 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.006G001900 [exp] 57 / 7e-12 AT4G05030 88 / 3e-24 Copper transport protein family (.1) Potri.006G001800 [exp] 56 / 4e-11 AT4G05030 73 / 2e-18 Copper transport protein family (.1) Potri.006G002000 [exp] 53 / 2e-10 AT4G05030 54 / 3e-11 Copper transport protein family (.1) Potri.016G002600 [exp] 51 / 1e-09 AT4G05030 72 / 2e-18 Copper transport protein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016060 pacid=23154430 polypeptide=Lus10016060 locus=Lus10016060.g ID=Lus10016060.BGIv1.0 annot-version=v1.0 ATGAACAACCACAAGTCAAGAACCAAGGCAATGAAAGTCGTGGTGGGAGTCCACGGCGTTGATTCGGCGTCGCTGGCTGGACCGGACAAGACCCAAATCG AGGTTACCGGCGACGGAATCGACTCGGCGGGTCTCGTAACCCTGCTTCGCAAAAAGGTTGGGTTTGCGGACTTGGTCAGCCTGGGTCCTGTAGAAGAGAA GAAGGAAGATGGCGATAAGCCGCCGGCGGAGGCGGATCCCAAACCGGAAGAAGAAAAAGAAGAAGTAGTGCTGCCGACGCCGGTCGATCTTTGGCCTTAC CAGTACGGCGGCGGTCAGCCTCACTACGTCAATCAAGTGAGGCCTTTTGGGGATCCGTATTATTACATGTATCGATGA
AA sequence Show only first row Show all	>Lus10016060 pacid=23154430 polypeptide=Lus10016060 locus=Lus10016060.g ID=Lus10016060.BGIv1.0 annot-version=v1.0 MNNHKSRTKAMKVVVGVHGVDSASLAGPDKTQIEVTGDGIDSAGLVTLLRKKVGFADLVSLGPVEEKKEDGDKPPAEADPKPEEEKEEVVLPTPVDLWPY QYGGGQPHYVNQVRPFGDPYYYMYR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07600			Heavy metal transport/detoxifi...		Lus10016060 [exp]	0	1
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001041 [exp]	1.0	0.9609
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001032 [exp]	2.4	0.9074
					Lus10003443 [exp]	8.8	0.8481
AT2G22180			hydroxyproline-rich glycoprote...		Lus10000688 [exp]	9.8	0.8741
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001042 [exp]	9.8	0.8641
					Lus10000824 [exp]	11.3	0.8741
AT1G48130		ATPER1	1-cysteine peroxiredoxin 1 (.1...		Lus10018342 [exp]	11.5	0.8062
AT4G05030			Copper transport protein famil...		Lus10039093 [exp]	11.8	0.7926
					Lus10003272 [exp]	12.6	0.8741
AT2G33470		ATGLTP1, GLTP1	ARABIDOPSIS GLYCOLIPID TRANSFE...		Lus10003626 [exp]	13.9	0.8741

Compare expression of checked genes

Lus10016060 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.