Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48290 77 / 1e-18 Heavy metal transport/detoxification superfamily protein (.1.2) AT3G07600 72 / 4e-17 Heavy metal transport/detoxification superfamily protein (.1) AT4G05030 54 / 2e-10 Copper transport protein family (.1) AT3G20180 53 / 3e-10 Copper transport protein family (.1) AT1G55790 47 / 5e-07 Domain of unknown function (DUF2431) (.1), Domain of unknown function (DUF2431) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025181 [exp] 129 / 3e-40 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016061 [exp] 125 / 2e-38 AT5G48290 82 / 1e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025180 [exp] 122 / 3e-37 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016060 [exp] 97 / 4e-27 AT3G07600 64 / 9e-14 Heavy metal transport/detoxification superfamily protein (.1) Lus10016063 [exp] 90 / 1e-24 AT3G07600 64 / 8e-14 Heavy metal transport/detoxification superfamily protein (.1) Lus10025182 [exp] 87 / 3e-23 AT5G48290 62 / 5e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025179 [exp] 68 / 1e-15 AT4G05030 62 / 1e-13 Copper transport protein family (.1) Lus10016059 [exp] 67 / 1e-15 AT4G05030 62 / 2e-13 Copper transport protein family (.1) Lus10007455 [exp] 44 / 7e-06 AT3G44480 98 / 1e-20 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G048300 [exp] 90 / 1e-24 AT3G07600 80 / 4e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G171300 [exp] 90 / 2e-24 AT3G07600 75 / 5e-18 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048400 [exp] 89 / 3e-24 AT3G07600 80 / 3e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048100 [exp] 89 / 4e-24 AT3G07600 79 / 8e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G171500 [exp] 89 / 5e-24 AT3G07600 73 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G001800 [exp] 69 / 1e-16 AT4G05030 73 / 2e-18 Copper transport protein family (.1) Potri.006G001900 [exp] 65 / 5e-15 AT4G05030 88 / 3e-24 Copper transport protein family (.1) Potri.006G002000 [exp] 59 / 5e-13 AT4G05030 54 / 3e-11 Copper transport protein family (.1) Potri.001G468500 [exp] 60 / 7e-13 AT4G05030 65 / 1e-14 Copper transport protein family (.1) Potri.018G023600 [exp] 62 / 1e-12 AT2G20142 86 / 7e-19 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10016062 pacid=23154347 polypeptide=Lus10016062 locus=Lus10016062.g ID=Lus10016062.BGIv1.0 annot-version=v1.0 ATGAAGCAAAAGGTTGTGATCAAGGTGACGATGAACAGCCAGAAGCTGAGAGCCAAGGCGATGACCGTCGTGGTCGGAGTCCGCGGCGTCGACTCCGCTT CGTTGGCCGGGCCGGAGAAGACCCAGATTGAGGTCACGGGCGACGGAGTTGATTCAGTTGAGCTCGTCTCTCTGCTCCGGAAGAAGGTTGGGTTTGCAGA GTTGGTCAGCGTCGCTCCCGTGGAAGAGAAGAAGAAGGAAGATCCCAAACCGGCGGAAGTCTTGCCGTCGCCAGCTGCCTTCTGGTCCTACGGATACCCC GGCGGTGCCCCATATTATGTCTATTAA
AA sequence Show only first row Show all	>Lus10016062 pacid=23154347 polypeptide=Lus10016062 locus=Lus10016062.g ID=Lus10016062.BGIv1.0 annot-version=v1.0 MKQKVVIKVTMNSQKLRAKAMTVVVGVRGVDSASLAGPEKTQIEVTGDGVDSVELVSLLRKKVGFAELVSVAPVEEKKKEDPKPAEVLPSPAAFWSYGYP GGAPYYVY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G48290			Heavy metal transport/detoxifi...		Lus10016062 [exp]	0	1
AT5G48290			Heavy metal transport/detoxifi...		Lus10016061 [exp]	1.4	0.9613
AT4G35600		Kin4, CX32, CST...	kinase 4, CONNEXIN 32, CAST AW...		Lus10008015 [exp]	2.4	0.9392
					Lus10011661 [exp]	3.2	0.9101
AT1G14040			EXS (ERD1/XPR1/SYG1) family pr...		Lus10037147 [exp]	3.7	0.9023
AT3G13130			unknown protein		Lus10012341 [exp]	4.0	0.9224
AT3G20410		CPK9	calmodulin-domain protein kina...		Lus10021531 [exp]	4.0	0.8932
AT4G02380		SAG21, ATLEA5	Arabidopsis thaliana late embr...		Lus10042672 [exp]	4.5	0.8902
AT5G48290			Heavy metal transport/detoxifi...		Lus10025181 [exp]	5.5	0.9231
					Lus10034871 [exp]	6.9	0.8729
AT1G14040			EXS (ERD1/XPR1/SYG1) family pr...		Lus10036779 [exp]	7.9	0.8637

Compare expression of checked genes

Lus10016062 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.