Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07600 57 / 4e-11 Heavy metal transport/detoxification superfamily protein (.1) AT5G48290 54 / 4e-10 Heavy metal transport/detoxification superfamily protein (.1.2) AT3G20180 52 / 1e-09 Copper transport protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025182 [exp] 142 / 7e-45 AT5G48290 62 / 5e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016062 [exp] 98 / 2e-27 AT5G48290 89 / 2e-23 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025181 [exp] 95 / 2e-26 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016061 [exp] 94 / 5e-26 AT5G48290 82 / 1e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025180 [exp] 84 / 3e-22 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016060 [exp] 80 / 2e-20 AT3G07600 64 / 9e-14 Heavy metal transport/detoxification superfamily protein (.1) Lus10025179 [exp] 56 / 5e-11 AT4G05030 62 / 1e-13 Copper transport protein family (.1) Lus10016059 [exp] 56 / 5e-11 AT4G05030 62 / 2e-13 Copper transport protein family (.1) Lus10039286 [exp] 43 / 1e-05 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G171300 [exp] 75 / 1e-18 AT3G07600 75 / 5e-18 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048300 [exp] 75 / 2e-18 AT3G07600 80 / 4e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048400 [exp] 74 / 4e-18 AT3G07600 80 / 3e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048100 [exp] 73 / 5e-18 AT3G07600 79 / 8e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G171500 [exp] 73 / 9e-18 AT3G07600 73 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G001900 [exp] 58 / 2e-12 AT4G05030 88 / 3e-24 Copper transport protein family (.1) Potri.001G378700 [exp] 56 / 4e-11 AT3G20180 56 / 5e-11 Copper transport protein family (.1) Potri.018G023600 [exp] 54 / 2e-09 AT2G20142 86 / 7e-19 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.006G001800 [exp] 50 / 2e-09 AT4G05030 73 / 2e-18 Copper transport protein family (.1) Potri.001G468500 [exp] 49 / 3e-08 AT4G05030 65 / 1e-14 Copper transport protein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016063 pacid=23154368 polypeptide=Lus10016063 locus=Lus10016063.g ID=Lus10016063.BGIv1.0 annot-version=v1.0 ATGAAGCAAAAGATAGTGATCAGTCTGCCGACGGTTAACAACCAGAAGTTGAGATCCAAGGCGATGAAGCTAGCGGTAGGTGTCGACGGCGTGAATTCCG CATCGTGGGCCGGGCCGGAGAAGACCCAACTTGAGGTCGCCGGTGACCGAATCGATCCTGTAAAGCTAGTGTGTCTGCTTCGGAAAAAGTTTGGATCTGC GGAGTTGGAAGCCGTGGCTCCAGTGGAAGAGAAGAAGGATGATAAGAAGAGTAAACCGTCGGAGGAAGGGTGGCCGTGGACAACACCGACCGTTTGGCCC TGCGGATATCCATGCTGCCCACCGTACTACTACGTCTATTGA
AA sequence Show only first row Show all	>Lus10016063 pacid=23154368 polypeptide=Lus10016063 locus=Lus10016063.g ID=Lus10016063.BGIv1.0 annot-version=v1.0 MKQKIVISLPTVNNQKLRSKAMKLAVGVDGVNSASWAGPEKTQLEVAGDRIDPVKLVCLLRKKFGSAELEAVAPVEEKKDDKKSKPSEEGWPWTTPTVWP CGYPCCPPYYYVY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07600			Heavy metal transport/detoxifi...		Lus10016063 [exp]	0	1
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10025410 [exp]	4.9	0.8779
AT3G57260		AtPR2, PR-2, PR...	PATHOGENESIS-RELATED PROTEIN 2...		Lus10027860 [exp]	7.6	0.8687
AT3G47110			Leucine-rich repeat protein ki...		Lus10030854 [exp]	8.5	0.6794
AT1G24140			Matrixin family protein (.1)		Lus10005605 [exp]	9.2	0.8673
AT1G24140			Matrixin family protein (.1)		Lus10039464 [exp]	11.3	0.8658
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10018379 [exp]	12.2	0.8579
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10024366 [exp]	13.9	0.8539
AT3G19270		CYP707A4	"cytochrome P450, family 707, ...		Lus10019858 [exp]	13.9	0.6513
AT5G51160			Ankyrin repeat family protein ...		Lus10034256 [exp]	14.2	0.8500
AT1G24140			Matrixin family protein (.1)		Lus10035221 [exp]	15.8	0.8473

Compare expression of checked genes

Lus10016063 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.