Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G28360 82 / 3e-20 SIT4 phosphatase-associated family protein (.1) AT3G45190 78 / 6e-19 SIT4 phosphatase-associated family protein (.1) AT1G07990 62 / 3e-13 SIT4 phosphatase-associated family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021468 [exp] 107 / 2e-29 AT3G45190 851 / 0.0 SIT4 phosphatase-associated family protein (.1) Lus10037400 [exp] 66 / 1e-14 AT1G07990 976 / 0.0 SIT4 phosphatase-associated family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G014700 [exp] 77 / 2e-18 AT1G07990 1019 / 0.0 SIT4 phosphatase-associated family protein (.1) Potri.004G211500 [exp] 75 / 7e-18 AT1G07990 991 / 0.0 SIT4 phosphatase-associated family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016089 pacid=23171813 polypeptide=Lus10016089 locus=Lus10016089.g ID=Lus10016089.BGIv1.0 annot-version=v1.0 ATGGACCAAGCACTCAAGGAAGGGATAGTCGGTGAAGCCGGACCACTGAAGAGGAACATTGCTCCGAGATTCCCTGAGAAGGACAACCACCCGGACGAGG TGAAGGAGTTCAATGATGCCAACTACTGGAAGGTTGATCAAGATGTCACTGTCCTGGAGTGA
AA sequence Show only first row Show all	>Lus10016089 pacid=23171813 polypeptide=Lus10016089 locus=Lus10016089.g ID=Lus10016089.BGIv1.0 annot-version=v1.0 MDQALKEGIVGEAGPLKRNIAPRFPEKDNHPDEVKEFNDANYWKVDQDVTVLE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G28360			SIT4 phosphatase-associated fa...		Lus10016089 [exp]	0	1
AT1G11925			Stigma-specific Stig1 family p...		Lus10012679 [exp]	1.7	0.9348
AT5G06540			Pentatricopeptide repeat (PPR)...		Lus10031430 [exp]	20.6	0.8613
AT3G08650			ZIP metal ion transporter fami...		Lus10035606 [exp]	20.6	0.9213
AT5G38630		ACYB-1	cytochrome B561-1 (.1)		Lus10003076 [exp]	20.7	0.9158
AT2G36305		RCE1, ATFACE2, ...	RAS-CONVERTING ENZYME 1, ARABI...		Lus10022724 [exp]	21.9	0.8871
AT1G02820			Late embryogenesis abundant 3 ...		Lus10008169 [exp]	21.9	0.9099
AT3G05550			Hypoxia-responsive family prot...		Lus10029883 [exp]	24.4	0.9260
AT5G59350			unknown protein		Lus10004955 [exp]	27.2	0.9216
AT3G61440		ATCYSC1, ARATH;...	BETA-SUBSTITUTED ALA SYNTHASE ...		Lus10036370 [exp]	27.6	0.9010
AT1G17100			SOUL heme-binding family prote...		Lus10013045 [exp]	28.6	0.9142

Compare expression of checked genes

Lus10016089 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.