Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G08010 142 / 1e-40 GATA GATA11 GATA transcription factor 11 (.1.2) AT1G08000 134 / 1e-37 GATA GATA10 GATA transcription factor 10 (.1.2) AT3G24050 125 / 2e-34 GATA GATA1 GATA transcription factor 1 (.1) AT5G66320 124 / 1e-33 GATA GATA5 GATA transcription factor 5 (.1.2) AT3G54810 123 / 2e-33 GATA GATA8, BME3, BME3-ZF GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) AT2G28340 120 / 1e-32 GATA GATA13 GATA transcription factor 13 (.1) AT4G36240 119 / 2e-32 GATA GATA7 GATA transcription factor 7 (.1) AT4G34680 119 / 3e-32 GATA GATA3 GATA transcription factor 3 (.1.2) AT3G51080 119 / 5e-32 GATA GATA6 GATA transcription factor 6 (.1) AT4G32890 115 / 2e-30 GATA GATA9 GATA transcription factor 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021466 [exp] 463 / 8e-168 AT1G08010 157 / 2e-46 GATA transcription factor 11 (.1.2) Lus10037398 [exp] 189 / 4e-59 AT1G08010 169 / 1e-50 GATA transcription factor 11 (.1.2) Lus10041313 [exp] 183 / 1e-56 AT1G08010 163 / 2e-48 GATA transcription factor 11 (.1.2) Lus10031096 [exp] 122 / 4e-35 AT5G66320 137 / 1e-40 GATA transcription factor 5 (.1.2) Lus10023684 [exp] 121 / 7e-34 AT3G24050 168 / 3e-52 GATA transcription factor 1 (.1) Lus10037994 [exp] 125 / 1e-33 AT3G54810 160 / 6e-46 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Lus10009227 [exp] 124 / 2e-33 AT3G54810 162 / 8e-47 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Lus10011762 [exp] 120 / 8e-33 AT3G24050 174 / 1e-53 GATA transcription factor 1 (.1) Lus10041810 [exp] 115 / 2e-31 AT5G66320 177 / 1e-54 GATA transcription factor 5 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G211800 [exp] 170 / 2e-51 AT1G08010 150 / 4e-43 GATA transcription factor 11 (.1.2) Potri.010G223300 [exp] 129 / 1e-35 AT3G54810 148 / 8e-42 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Potri.008G038900 [exp] 127 / 9e-35 AT3G54810 150 / 1e-42 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Potri.004G161500 [exp] 120 / 3e-32 AT5G66320 178 / 2e-53 GATA transcription factor 5 (.1.2) Potri.009G123400 [exp] 120 / 3e-32 AT5G66320 179 / 8e-54 GATA transcription factor 5 (.1.2) Potri.013G059600 [exp] 119 / 6e-32 AT5G25830 128 / 1e-34 GATA transcription factor 12 (.1) Potri.003G174800 [exp] 116 / 2e-31 AT3G24050 167 / 6e-51 GATA transcription factor 1 (.1) Potri.019G033000 [exp] 117 / 3e-31 AT4G32890 127 / 2e-34 GATA transcription factor 9 (.1) Potri.001G188500 [exp] 117 / 4e-31 AT4G32890 201 / 7e-63 GATA transcription factor 9 (.1) Potri.001G053500 [exp] 115 / 5e-31 AT3G24050 171 / 4e-52 GATA transcription factor 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF00320 [flax] [poplar] GATA GATA zinc finger
Representative CDS sequence Show only first row Show all	>Lus10016092 pacid=23171836 polypeptide=Lus10016092 locus=Lus10016092.g ID=Lus10016092.BGIv1.0 annot-version=v1.0 ATGGCCGACTCTTGGTTTTACGATTTAGCCAATTTTAGCGGGTTCCCTGATGATTTCTCGTTGGAGAACATAGATTTGTCTCTAGAATCTCTAGAGGACG TTGATCCTGCAGTGGACTGGGACACTAAGTTCAAAGACCTTGAGCCTCCTTCAGTTTTCCTGCCCAACTTCCCGCCTGATATCCCCAGTGCTAATGACAT CAAACCTGTGAAAGTGGAGGGCACTTCAGTTCTGAAAAATGAATCTCCCGAGTTGAAAAAGTCGTTCCGAACCTCAAGTCCAGTATCTGTCCTGGACAAC AATAGCAGCTCTTCTTGCTCGGCCGAGATCCCAACCAGACGCCCTCGAAGCAAAGGCGTTCGCTCGCAGCGCCGCACCTATGAGTTCTTCCACCGTCTCT TTGCCGGTGAAAGGCGGCTTCACCCGGTAGCCCCTCTCAACTCCGAAACTGAATCCAACAAGAAGAAGAATCTCACCGCTGTTTCTCGCAACATCTCAGA AGCTGCCAAGAAGAAGAAGCAGCCTGTTATTAACAGCAAATGCTCTCACTGCGGGGTGACACATACTCCTCAGTGGAGAGAAGGACCAATGGGCCCGAAG ACTCTCTGCAACGCTTGTGGGGTCCGCCACAGGTCTGGCCGTCTTTTCCCTGAGTACCGCCCTGCTGGCAGTCCAACCTTCGTCCCCGAACTCCACTCCA ACTCGCACAGGAAGGTTCTCGAGATGAGGATGAAAGCTTCGTCCTCCAATGGACCCTGA
AA sequence Show only first row Show all	>Lus10016092 pacid=23171836 polypeptide=Lus10016092 locus=Lus10016092.g ID=Lus10016092.BGIv1.0 annot-version=v1.0 MADSWFYDLANFSGFPDDFSLENIDLSLESLEDVDPAVDWDTKFKDLEPPSVFLPNFPPDIPSANDIKPVKVEGTSVLKNESPELKKSFRTSSPVSVLDN NSSSSCSAEIPTRRPRSKGVRSQRRTYEFFHRLFAGERRLHPVAPLNSETESNKKKNLTAVSRNISEAAKKKKQPVINSKCSHCGVTHTPQWREGPMGPK TLCNACGVRHRSGRLFPEYRPAGSPTFVPELHSNSHRKVLEMRMKASSSNGP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G08010	GATA	GATA11	GATA transcription factor 11 (...		Lus10016092 [exp]	0	1
AT5G64970			Mitochondrial substrate carrie...		Lus10014334 [exp]	1.0	0.8963
AT4G32330			TPX2 (targeting protein for Xk...		Lus10002915 [exp]	1.7	0.8771
AT5G05950		MEE60	maternal effect embryo arrest ...		Lus10009873 [exp]	2.8	0.8747
AT1G80350		FTR, FRC2, FRA2...	KATANIN 1, FAT ROOT, FURCA2, F...		Lus10023115 [exp]	6.7	0.8742
AT3G12110		ACT11	actin-11 (.1)		Lus10040826 [exp]	6.8	0.8836
AT1G32860			Glycosyl hydrolase superfamily...		Lus10033244 [exp]	7.1	0.8605
AT5G55730		FLA1	FASCICLIN-like arabinogalactan...		Lus10016617 [exp]	7.5	0.8684
AT5G66770	GRAS		GRAS family transcription fact...		Lus10041740 [exp]	7.7	0.8542
AT5G40710	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10014570 [exp]	8.3	0.8302
AT5G64970			Mitochondrial substrate carrie...		Lus10026043 [exp]	8.5	0.8695

Compare expression of checked genes

Lus10016092 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.