Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G28305 385 / 5e-138 ATLOG1 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) AT2G37210 375 / 3e-134 LOG3 LONELY GUY 3, lysine decarboxylase family protein (.1.2) AT3G53450 367 / 5e-131 LOG4 LONELY GUY 4, Putative lysine decarboxylase family protein (.1) AT5G06300 340 / 3e-120 LOG7 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) AT4G35190 320 / 4e-112 LOG5 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) AT2G35990 314 / 6e-110 LOG2 LONELY GUY 2, Putative lysine decarboxylase family protein (.1.2.3) AT5G11950 296 / 1e-102 LOG8 LONELY GUY 8, Putative lysine decarboxylase family protein (.1.2) AT5G03270 270 / 2e-92 LOG6 LONELY GUY 6, lysine decarboxylase family protein (.1) AT5G26140 165 / 2e-52 ATLOG9 LONELY GUY 9, Putative lysine decarboxylase family protein (.1) AT1G50575 45 / 1e-05 Putative lysine decarboxylase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021462 [exp] 437 / 2e-158 AT2G28305 386 / 1e-138 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Lus10026513 [exp] 374 / 3e-133 AT2G37210 394 / 1e-141 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10002226 [exp] 366 / 2e-130 AT2G37210 379 / 2e-135 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10023190 [exp] 356 / 2e-126 AT2G37210 364 / 6e-130 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10012436 [exp] 341 / 2e-120 AT5G06300 332 / 7e-117 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10024328 [exp] 337 / 9e-119 AT5G06300 328 / 2e-115 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10025117 [exp] 331 / 4e-116 AT4G35190 373 / 1e-132 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Lus10003335 [exp] 328 / 3e-115 AT4G35190 359 / 2e-127 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Lus10022638 [exp] 326 / 3e-114 AT4G35190 365 / 2e-129 LONELY GUY 5, Putative lysine decarboxylase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G212200 [exp] 395 / 7e-142 AT2G28305 361 / 1e-128 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.009G010800 [exp] 394 / 1e-141 AT2G28305 359 / 8e-128 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.006G127400 [exp] 381 / 2e-136 AT2G37210 396 / 3e-142 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.016G090500 [exp] 380 / 5e-136 AT2G37210 392 / 8e-141 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.002G012500 [exp] 348 / 3e-123 AT4G35190 300 / 5e-104 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Potri.002G024000 [exp] 345 / 6e-122 AT2G37210 310 / 2e-108 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.005G237600 [exp] 344 / 1e-121 AT5G06300 338 / 2e-119 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Potri.005G248900 [exp] 339 / 8e-120 AT4G35190 297 / 7e-103 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Potri.006G204800 [exp] 328 / 1e-115 AT5G06300 316 / 9e-111 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Potri.004G181800 [exp] 328 / 2e-115 AT4G35190 361 / 3e-128 LONELY GUY 5, Putative lysine decarboxylase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0349 [flax] [poplar] SLOG PF03641 [flax] [poplar] Lysine_decarbox Possible lysine decarboxylase
Representative CDS sequence Show only first row Show all	>Lus10016096 pacid=23171812 polypeptide=Lus10016096 locus=Lus10016096.g ID=Lus10016096.BGIv1.0 annot-version=v1.0 ATGGAGATGGAGATGAAGCCGTCGAAATTCAAGAGGGTTTGTGTGTTCTGTGGGAGTAGCCCTGGCAAGAAAACTAGTTATAAAGATGCTGCTGTCGATC TTGGAACTGAACTGGTGTCCAAGAATATTGATCTAGTGTATGGAGGAGGGAGTATTGGTCTGATGGGACTGGTCTCTCAAGCCGTTTACGAAGGCGGCCG CCACGTCATCGGGGTCATTCCGAAGACATTAATGCCTCGAGAGTTGACCGGAGAAACAGTGGGAGAAGTCAAAGCAGTTGCAGATATGCATCAGCGAAAG GCGGAGATGGCTCGTCACTCTGACGCCTTCATCGCACTACCTGGCGGTTACGGAACCTTGGAAGAGCTTCTTGAAGTGATAACATGGGCACAACTCGGAA TCCATGACAAGCCGGTGGGGTTATTGAATGTGGATGGATACTACAATTCACTGCTATCATTCATAGACAAAGCTGTGGAGGAAGGCTTCATTAGTCCAAC TGCTCGCCACATCATTGTCTCTGCCCCTAATGCCAAAGAGTTGGTCAAGAAAATGGAGGAGTATTTACCGAAGCATGAAAGAGTTGCATCCAAGCTAAGT TGGGAGGTGGAACAACTAGAGTTGGAGCATTCCACAAAGTGTGAAATCTCGAGGTGA
AA sequence Show only first row Show all	>Lus10016096 pacid=23171812 polypeptide=Lus10016096 locus=Lus10016096.g ID=Lus10016096.BGIv1.0 annot-version=v1.0 MEMEMKPSKFKRVCVFCGSSPGKKTSYKDAAVDLGTELVSKNIDLVYGGGSIGLMGLVSQAVYEGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRK AEMARHSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTARHIIVSAPNAKELVKKMEEYLPKHERVASKLS WEVEQLELEHSTKCEISR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G28305		ATLOG1	LONELY GUY 1, Putative lysine ...		Lus10016096 [exp]	0	1
AT2G28305		ATLOG1	LONELY GUY 1, Putative lysine ...		Lus10021462 [exp]	1.0	0.9278
AT2G42280	bHLH	bHLH130	basic helix-loop-helix (bHLH) ...		Lus10037484 [exp]	2.0	0.9173
AT3G52420		ATOEP7	outer envelope membrane protei...		Lus10003733 [exp]	2.8	0.8906
AT1G70480			Domain of unknown function (DU...		Lus10013018 [exp]	4.8	0.8532
AT5G17680			disease resistance protein (TI...		Lus10041060 [exp]	8.1	0.8698
AT3G27050			unknown protein		Lus10032042 [exp]	8.1	0.8542
AT4G38620	MYB	AtMYB4	myb domain protein 4 (.1)		Lus10041888 [exp]	8.5	0.8739
AT3G02750			Protein phosphatase 2C family ...		Lus10022683 [exp]	9.6	0.8990
					Lus10039759 [exp]	12.2	0.8891
					Lus10040066 [exp]	13.0	0.8837

Compare expression of checked genes

Lus10016096 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.