Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037393 [exp] 92 / 1e-25 AT2G26040 39 / 5e-04 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Lus10041320 [exp] 88 / 6e-24 ND 37 / 0.003 Lus10026077 [exp] 63 / 5e-14 ND / Lus10002306 [exp] 61 / 6e-13 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G088100 [exp] 61 / 1e-13 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016100 pacid=23171834 polypeptide=Lus10016100 locus=Lus10016100.g ID=Lus10016100.BGIv1.0 annot-version=v1.0 ATGATCAGAGGGAAGATAGTTCACGAAGCTCCGGTGGAAGCTCCGGAGACGGTGGTGTGGGAATCATACCTGGGGCTTGAGCTTTCCCGGCTGGTTAATG AACTCATGCCACATCTCGTCGGCACCGTGGAAGTCATCGGCACCGTCGTCAAACTCACTTTTCCTCCAGGAACTCCCGGGCCCGGGTAG
AA sequence Show only first row Show all	>Lus10016100 pacid=23171834 polypeptide=Lus10016100 locus=Lus10016100.g ID=Lus10016100.BGIv1.0 annot-version=v1.0 MIRGKIVHEAPVEAPETVVWESYLGLELSRLVNELMPHLVGTVEVIGTVVKLTFPPGTPGPG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10016100 [exp]	0	1
AT5G25840			Protein of unknown function (D...		Lus10011427 [exp]	1.0	0.9532
AT5G65730		XTH6, XTR10	xyloglucan endotransglucosylas...		Lus10039643 [exp]	3.2	0.9269
AT5G49340		TBL4	TRICHOME BIREFRINGENCE-LIKE 4 ...		Lus10016856 [exp]	3.7	0.9018
					Lus10000488 [exp]	3.9	0.9244
AT5G65730		XTH6, XTR10	xyloglucan endotransglucosylas...		Lus10011597 [exp]	5.0	0.9148
AT4G34810			SAUR-like auxin-responsive pro...		Lus10042379 [exp]	5.2	0.8835
AT1G12480		SLAC1, RCD3, CD...	SLOW ANION CHANNEL-ASSOCIATED ...		Lus10007023 [exp]	6.3	0.8925
AT2G47490		ATNDT1	NAD+ transporter 1, ARABIDOPSI...		Lus10001463 [exp]	6.6	0.9238
AT1G79600			Protein kinase superfamily pro...		Lus10035701 [exp]	7.1	0.8563
					Lus10035457 [exp]	7.7	0.8651

Compare expression of checked genes

Lus10016100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.