Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041320 [exp] 77 / 2e-19 ND 37 / 0.003 Lus10037393 [exp] 74 / 3e-18 AT2G26040 39 / 5e-04 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Lus10002306 [exp] 65 / 2e-14 ND / Lus10026077 [exp] 64 / 5e-14 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G088100 [exp] 72 / 8e-18 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016101 pacid=23171844 polypeptide=Lus10016101 locus=Lus10016101.g ID=Lus10016101.BGIv1.0 annot-version=v1.0 ATGGACGACGAAAATCGAGGGAAGGAATCAGACACGATAGAAGAAGGGCTTCTCGATTTCGGATTCAATTGTTACAAAATTCAAATCGAGGTTATTGAGG AACAAAGATATAGTATCATCCGATCCACGATCAAGTACGAGCGGAGAGACGATTTGAAAGCCGACCTTGTCTCGCAAGTCACCATTCAATCACTTACCAC GATAGCTAATGTTGTTGGCGATTACATTATGTGA
AA sequence Show only first row Show all	>Lus10016101 pacid=23171844 polypeptide=Lus10016101 locus=Lus10016101.g ID=Lus10016101.BGIv1.0 annot-version=v1.0 MDDENRGKESDTIEEGLLDFGFNCYKIQIEVIEEQRYSIIRSTIKYERRDDLKADLVSQVTIQSLTTIANVVGDYIM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10016101 [exp]	0	1
AT5G65730		XTH6, XTR10	xyloglucan endotransglucosylas...		Lus10011597 [exp]	3.0	0.8829
AT3G22840		ELIP1	EARLY LIGHT-INDUCABLE PROTEIN,...		Lus10039378 [exp]	4.9	0.8782
AT4G21200		ATGA2OX8	ARABIDOPSIS THALIANA GIBBERELL...		Lus10006759 [exp]	5.9	0.8725
AT3G03430			Calcium-binding EF-hand family...		Lus10033587 [exp]	7.9	0.8826
AT5G20860			Plant invertase/pectin methyle...		Lus10017665 [exp]	12.8	0.8766
AT1G78955		CAMS1	camelliol C synthase 1 (.1)		Lus10016441 [exp]	13.2	0.8679
AT1G78950		ATLUP3	Terpenoid cyclases family prot...		Lus10016440 [exp]	15.1	0.8722
AT1G15360	AP2_ERF	WIN1, SHN1	WAX INDUCER 1, SHINE 1, Integr...		Lus10030097 [exp]	20.4	0.8571
AT1G66370	MYB	ATMYB113	myb domain protein 113 (.1)		Lus10023027 [exp]	21.6	0.7871
AT4G33010		ATGLDP1	glycine decarboxylase P-protei...		Lus10024989 [exp]	22.2	0.8236

Compare expression of checked genes

Lus10016101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.