Lus10016112 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G15042 101 / 2e-25 Leucine-rich repeat (LRR) family protein (.1)
AT5G25910 98 / 3e-24 AtRLP52 receptor like protein 52 (.1)
AT3G05660 98 / 4e-24 AtRLP33 receptor like protein 33 (.1)
AT3G11010 97 / 1e-23 AtRLP34 receptor like protein 34 (.1)
AT2G15080 93 / 2e-22 AtRLP19 receptor like protein 19 (.1.2)
AT3G05650 92 / 3e-22 AtRLP32 receptor like protein 32 (.1)
AT1G47890 89 / 5e-21 AtRLP7 receptor like protein 7 (.1)
AT5G27060 87 / 3e-20 AtRLP53 receptor like protein 53 (.1)
AT3G11080 86 / 7e-20 AtRLP35 receptor like protein 35 (.1)
AT2G25470 85 / 1e-19 AtRLP21 receptor like protein 21 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004313 177 / 3e-52 AT2G33060 335 / 5e-103 receptor like protein 27 (.1)
Lus10004310 176 / 1e-51 AT2G33060 358 / 6e-111 receptor like protein 27 (.1)
Lus10004309 154 / 3e-46 AT1G47890 225 / 6e-66 receptor like protein 7 (.1)
Lus10006824 144 / 9e-41 AT3G23110 185 / 2e-50 EMBRYO DEFECTIVE 2800, receptor like protein 37 (.1)
Lus10002214 138 / 7e-39 AT3G05660 293 / 2e-89 receptor like protein 33 (.1)
Lus10003387 135 / 4e-37 AT1G47890 394 / 3e-120 receptor like protein 7 (.1)
Lus10006825 130 / 2e-35 AT1G47890 377 / 6e-114 receptor like protein 7 (.1)
Lus10003389 129 / 6e-35 AT1G45616 432 / 7e-135 receptor like protein 6 (.1)
Lus10026415 126 / 7e-34 AT1G47890 424 / 3e-131 receptor like protein 7 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G120600 130 / 1e-35 AT1G47890 441 / 7e-137 receptor like protein 7 (.1)
Potri.016G120532 123 / 4e-33 AT1G45616 325 / 9e-98 receptor like protein 6 (.1)
Potri.012G016715 110 / 4e-29 AT2G33060 247 / 1e-74 receptor like protein 27 (.1)
Potri.012G005600 109 / 3e-28 AT1G45616 379 / 3e-115 receptor like protein 6 (.1)
Potri.012G028101 107 / 2e-27 AT3G11080 400 / 1e-123 receptor like protein 35 (.1)
Potri.012G021940 105 / 2e-27 AT2G33060 229 / 6e-68 receptor like protein 27 (.1)
Potri.012G020600 106 / 3e-27 AT3G05660 372 / 2e-115 receptor like protein 33 (.1)
Potri.012G029000 105 / 6e-27 AT3G05660 373 / 2e-114 receptor like protein 33 (.1)
Potri.012G027600 105 / 1e-26 AT1G71400 395 / 1e-121 receptor like protein 12 (.1)
Potri.012G019850 105 / 1e-26 AT4G13810 309 / 2e-94 receptor like protein 47 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0022 LRR PF00560 LRR_1 Leucine Rich Repeat
Representative CDS sequence
>Lus10016112 pacid=23171794 polypeptide=Lus10016112 locus=Lus10016112.g ID=Lus10016112.BGIv1.0 annot-version=v1.0
ATGGATTATGAAAACAGAACACAAGATCTCATCAAATTTAAGTCGTCCACAGCATTAGGTGGCTATTATCAAGATTCCATAACCGTGAGCAAGGGTTCTG
GTGTCGAATTGAAATTTGTGAAGGTCTTGAATATATTTAAGTATATTGATTTGTCAAGCCACAATTTTAGTGGGCCAATACCAAAAGTTATAGGAAATTT
CAAAGCACTCAAGGTTCTCAACTTATCCCACAATGCTTTTATTAGCCGAATTCCATCAACATTTGGTAACTTGTCAAGCTTGGAGTCTCTAAACCTCTCT
CATAAAATGCTTAGTGGACATATACCAATGGAGTTAGCGGACTTGACATTCCTTGCAATCTTGAACCTTTCGGTTAATCATTTAGTTGGCAGCATCCCAA
TCGGCAGACAATTACAAACATTTGAAGGCCAAAACCGACGGAGCAACAAGCGGACAGTGAAAACCCGGTCACCACCCCTGCAATTTCATAATGCCTAA
AA sequence
>Lus10016112 pacid=23171794 polypeptide=Lus10016112 locus=Lus10016112.g ID=Lus10016112.BGIv1.0 annot-version=v1.0
MDYENRTQDLIKFKSSTALGGYYQDSITVSKGSGVELKFVKVLNIFKYIDLSSHNFSGPIPKVIGNFKALKVLNLSHNAFISRIPSTFGNLSSLESLNLS
HKMLSGHIPMELADLTFLAILNLSVNHLVGSIPIGRQLQTFEGQNRRSNKRTVKTRSPPLQFHNA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G25910 AtRLP52 receptor like protein 52 (.1) Lus10016112 0 1
AT4G35420 TKPR1, DRL1 tetraketide alpha-pyrone reduc... Lus10006141 1.7 0.9293
AT5G45840 Leucine-rich repeat protein ki... Lus10007281 2.8 0.8895
Lus10040835 3.5 0.8570
AT1G07860 unknown protein Lus10036143 6.3 0.7614
Lus10009381 6.7 0.8144
Lus10005747 7.2 0.8481
AT3G14040 Pectin lyase-like superfamily ... Lus10041051 7.3 0.6206
AT1G65810 P-loop containing nucleoside t... Lus10035774 7.5 0.8030
Lus10041320 9.2 0.8102
AT2G29880 unknown protein Lus10005028 9.5 0.7159

Lus10016112 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.