Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014871 [exp] 74 / 6e-19 ND / Lus10004111 [exp] 73 / 2e-18 ND / Lus10010397 [exp] 71 / 1e-17 ND / Lus10008153 [exp] 66 / 8e-16 ND / Lus10003026 [exp] 67 / 3e-15 AT2G25010 45 / 4e-05 Aminotransferase-like, plant mobile domain family protein (.1) Lus10026446 [exp] 63 / 2e-14 ND / Lus10011618 [exp] 60 / 3e-13 ND / Lus10033928 [exp] 61 / 1e-12 AT4G16310 1391 / 0.0 LSD1-like 3 (.1) Lus10015869 [exp] 55 / 4e-11 AT1G48120 44 / 3e-05 hydrolases;protein serine/threonine phosphatases (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016118 pacid=23171799 polypeptide=Lus10016118 locus=Lus10016118.g ID=Lus10016118.BGIv1.0 annot-version=v1.0 ATGACAGATGATCCTCCAGTTCCCGAGTGGCTGCAGCAATCCATTGCCGACTGTATTGTTGATGGATTGATGCTCCTTTGGGAAGCGGACACTGTAGATG CTTTTTTGAATAGAGGAGCAGATCATTTCTTTTTGATTCAGTCCACGAAGGGGTTGTTTAGGGAGTATATGTCGTAG
AA sequence Show only first row Show all	>Lus10016118 pacid=23171799 polypeptide=Lus10016118 locus=Lus10016118.g ID=Lus10016118.BGIv1.0 annot-version=v1.0 MTDDPPVPEWLQQSIADCIVDGLMLLWEADTVDAFLNRGADHFFLIQSTKGLFREYMS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10016118 [exp]	0	1
AT1G05675			UDP-Glycosyltransferase superf...		Lus10010469 [exp]	1.0	1.0000
AT4G02780		ATCPS1, ABC33, ...	GA REQUIRING 1, CPP synthase, ...		Lus10004323 [exp]	2.0	0.9631
AT3G07880		SCN1	SUPERCENTIPEDE1, Immunoglobuli...		Lus10027327 [exp]	2.0	0.9168
AT5G17540			HXXXD-type acyl-transferase fa...		Lus10005660 [exp]	2.4	0.9216
AT5G39300		ATHEXPALPHA1.18...	EXPANSIN 25, expansin A25 (.1)		Lus10000305 [exp]	3.2	0.9029
AT5G06700		TBR	TRICHOME BIREFRINGENCE, Plant ...		Lus10033616 [exp]	3.5	0.7979
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10012493 [exp]	4.0	0.7807
AT2G14378			Protein of unknown function (D...		Lus10019428 [exp]	6.2	0.6897
					Lus10026491 [exp]	7.4	0.7277
AT2G43820		SGT1, ATSAGT1, ...	UDP-glucose:salicylic acid glu...		Lus10006352 [exp]	8.8	0.7886

Compare expression of checked genes

Lus10016118 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.