Lus10016129 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G28085 115 / 8e-34 SAUR-like auxin-responsive protein family (.1)
AT3G09870 81 / 2e-20 SAUR-like auxin-responsive protein family (.1)
AT4G38860 69 / 7e-16 SAUR-like auxin-responsive protein family (.1)
AT4G34800 66 / 7e-15 SAUR-like auxin-responsive protein family (.1)
AT2G21210 64 / 3e-14 SAUR-like auxin-responsive protein family (.1)
AT4G34750 64 / 2e-13 SAUR-like auxin-responsive protein family (.1.2)
AT4G34770 62 / 2e-13 SAUR-like auxin-responsive protein family (.1)
AT4G34780 62 / 3e-13 SAUR-like auxin-responsive protein family (.1)
AT2G46690 62 / 5e-13 SAUR-like auxin-responsive protein family (.1)
AT3G20220 62 / 5e-13 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021436 235 / 7e-81 AT2G28085 117 / 6e-35 SAUR-like auxin-responsive protein family (.1)
Lus10021435 199 / 1e-66 AT2G28085 108 / 4e-31 SAUR-like auxin-responsive protein family (.1)
Lus10016130 199 / 1e-66 AT2G28085 111 / 2e-32 SAUR-like auxin-responsive protein family (.1)
Lus10001397 81 / 2e-20 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1)
Lus10030263 78 / 7e-19 AT3G09870 100 / 4e-28 SAUR-like auxin-responsive protein family (.1)
Lus10004014 75 / 6e-18 AT3G09870 101 / 1e-28 SAUR-like auxin-responsive protein family (.1)
Lus10026532 73 / 3e-17 AT3G09870 64 / 3e-14 SAUR-like auxin-responsive protein family (.1)
Lus10013819 73 / 4e-17 AT3G09870 92 / 7e-25 SAUR-like auxin-responsive protein family (.1)
Lus10026531 71 / 2e-16 AT3G09870 89 / 7e-24 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G226400 106 / 2e-30 AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1)
Potri.016G092400 100 / 4e-28 AT3G09870 108 / 8e-32 SAUR-like auxin-responsive protein family (.1)
Potri.006G125100 93 / 5e-25 AT3G09870 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Potri.009G127400 70 / 3e-16 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1)
Potri.009G127600 66 / 1e-14 AT5G18080 116 / 7e-35 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
Potri.009G127700 65 / 1e-14 AT5G18080 114 / 1e-34 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
Potri.009G127500 63 / 1e-13 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1)
Potri.004G165300 63 / 1e-13 AT4G38840 130 / 6e-41 SAUR-like auxin-responsive protein family (.1)
Potri.004G164400 63 / 1e-13 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1)
Potri.009G126900 63 / 1e-13 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10016129 pacid=23171856 polypeptide=Lus10016129 locus=Lus10016129.g ID=Lus10016129.BGIv1.0 annot-version=v1.0
ATGGCTCCTACTACTAGCAAGAACAAGGGAAGTGGAGGCATAATCAAGCTCAAGATAGTTGCAAAGAAGCTCCAAAAGAGCCTCAATTCCTTGGGGATCA
AGAAGGAAAACAATATCCCTGGGGACGTTAAAGAAGGCCACTTTGCGGTTTTAGCTGTGGAAGGAGTTGAAGAGCCTCAGAGGTTCGTGGTGCCTTTGAC
TTATCTCACTCACCCTACATTTCTGAGGCTCTTGGAGCAGGCTGCAGAAGAGTATGGGTTTGAAGGGCGCGAGGGCGCTCTTGCTGTCCCTTGTAGGCCT
TCGGAGCTCGAGAGGATCTTGTCGGAGCAATGGGAAAAAAGTATTGAGTCGTCAAGGGGAAGGATGATGAACAATGGTGGTGGTGGTAGTGATAGTTGGG
GTTCTTCCCCTTGTAAGACTATGGTGTCAAGCTTTTGA
AA sequence
>Lus10016129 pacid=23171856 polypeptide=Lus10016129 locus=Lus10016129.g ID=Lus10016129.BGIv1.0 annot-version=v1.0
MAPTTSKNKGSGGIIKLKIVAKKLQKSLNSLGIKKENNIPGDVKEGHFAVLAVEGVEEPQRFVVPLTYLTHPTFLRLLEQAAEEYGFEGREGALAVPCRP
SELERILSEQWEKSIESSRGRMMNNGGGGSDSWGSSPCKTMVSSF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G28085 SAUR-like auxin-responsive pro... Lus10016129 0 1
AT4G38840 SAUR-like auxin-responsive pro... Lus10038191 1.0 0.9416
AT5G10770 Eukaryotic aspartyl protease f... Lus10026243 1.7 0.8608
AT2G28085 SAUR-like auxin-responsive pro... Lus10021436 3.5 0.8826
AT1G80760 NLM7, NIP6;1 NOD26-like intrinsic protein 6... Lus10041674 3.9 0.8590
AT5G62280 Protein of unknown function (D... Lus10031701 13.2 0.8476
AT2G47770 ATTSPO TSPO(outer membrane tryptophan... Lus10010281 13.9 0.8500
AT2G40610 ATHEXPALPHA1.11... expansin A8 (.1) Lus10029038 14.3 0.8206
AT5G62360 Plant invertase/pectin methyle... Lus10038915 18.5 0.8190
AT1G08350 Endomembrane protein 70 protei... Lus10020613 18.9 0.8598
AT2G39770 VTC1, SOZ1, GMP... VITAMIN C DEFECTIVE 1, SENSITI... Lus10030156 23.9 0.8381

Lus10016129 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.