Lus10016130 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G28085 111 / 3e-32 SAUR-like auxin-responsive protein family (.1)
AT3G09870 77 / 5e-19 SAUR-like auxin-responsive protein family (.1)
AT4G34800 68 / 1e-15 SAUR-like auxin-responsive protein family (.1)
AT4G38860 67 / 2e-15 SAUR-like auxin-responsive protein family (.1)
AT2G21210 67 / 3e-15 SAUR-like auxin-responsive protein family (.1)
AT4G34760 64 / 5e-14 SAUR-like auxin-responsive protein family (.1)
AT4G34780 64 / 6e-14 SAUR-like auxin-responsive protein family (.1)
AT1G75580 62 / 2e-13 SAUR-like auxin-responsive protein family (.1)
AT4G34770 62 / 3e-13 SAUR-like auxin-responsive protein family (.1)
AT4G34810 62 / 3e-13 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021435 240 / 3e-83 AT2G28085 108 / 4e-31 SAUR-like auxin-responsive protein family (.1)
Lus10016129 199 / 5e-67 AT2G28085 115 / 4e-34 SAUR-like auxin-responsive protein family (.1)
Lus10021436 198 / 2e-66 AT2G28085 117 / 6e-35 SAUR-like auxin-responsive protein family (.1)
Lus10001397 80 / 6e-20 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1)
Lus10030263 77 / 7e-19 AT3G09870 100 / 4e-28 SAUR-like auxin-responsive protein family (.1)
Lus10004014 75 / 6e-18 AT3G09870 101 / 1e-28 SAUR-like auxin-responsive protein family (.1)
Lus10013819 72 / 1e-16 AT3G09870 92 / 7e-25 SAUR-like auxin-responsive protein family (.1)
Lus10026532 71 / 2e-16 AT3G09870 64 / 3e-14 SAUR-like auxin-responsive protein family (.1)
Lus10026531 71 / 2e-16 AT3G09870 89 / 7e-24 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G226400 106 / 1e-30 AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1)
Potri.016G092400 98 / 3e-27 AT3G09870 108 / 8e-32 SAUR-like auxin-responsive protein family (.1)
Potri.006G125100 91 / 4e-24 AT3G09870 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Potri.009G127400 71 / 8e-17 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1)
Potri.009G127600 71 / 4e-16 AT5G18080 116 / 7e-35 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
Potri.009G127700 69 / 4e-16 AT5G18080 114 / 1e-34 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
Potri.004G164400 67 / 4e-15 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1)
Potri.004G165600 66 / 7e-15 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1)
Potri.009G126000 66 / 7e-15 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1)
Potri.004G165300 65 / 2e-14 AT4G38840 130 / 6e-41 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10016130 pacid=23171832 polypeptide=Lus10016130 locus=Lus10016130.g ID=Lus10016130.BGIv1.0 annot-version=v1.0
ATGGCTCATACTTCAAGCAAGAACAAAGGGAATGGAGGCATCACCAACCTCAAGATAGTGGCAAAGAAGCTTCAAAAGAGCCTCAATTCCTTGGGGAAGA
AGGCAACCAATGTCCCCGGAGACGTTAAAGAAGGACACTTTGCGGTGTTAGCTGTGGAAGGAGTCAAAGAGCCGCAGAGGTTCGTCGTACCCTTATCTTA
TCTGACCCACCCTACATTCTTGAGGCTCTTGGAGAAGGCAGCCGAGGAGTATGGGTTCGATGGCTATGAGGGTGCCCTTGTGGTCCCTTGTAGACCATCA
GAGCTCGAGAGGATCTTGGCAGAGCAATGGAAGGAAACGAGGTCGACTAATCGAGGGAGGCACGATGGTGGTAGTGATGGTGGTTGGAGTAGTACTTCTT
CTTGTAAGACTATGGTGCCAAGCTTTTGA
AA sequence
>Lus10016130 pacid=23171832 polypeptide=Lus10016130 locus=Lus10016130.g ID=Lus10016130.BGIv1.0 annot-version=v1.0
MAHTSSKNKGNGGITNLKIVAKKLQKSLNSLGKKATNVPGDVKEGHFAVLAVEGVKEPQRFVVPLSYLTHPTFLRLLEKAAEEYGFDGYEGALVVPCRPS
ELERILAEQWKETRSTNRGRHDGGSDGGWSSTSSCKTMVPSF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G28085 SAUR-like auxin-responsive pro... Lus10016130 0 1
AT2G30900 TBL43 TRICHOME BIREFRINGENCE-LIKE 43... Lus10020786 2.4 0.9490
AT5G04870 AK1, ATCPK1, CP... calcium dependent protein kina... Lus10029358 5.7 0.9558
Lus10039897 9.0 0.9251
AT5G59810 ATSBT5.4 Subtilase family protein (.1) Lus10008982 9.6 0.8484
Lus10018225 12.8 0.9411
AT2G34160 Alba DNA/RNA-binding protein (... Lus10021222 15.6 0.8246
AT2G28085 SAUR-like auxin-responsive pro... Lus10021435 16.0 0.9375
AT5G59810 ATSBT5.4 Subtilase family protein (.1) Lus10028844 17.2 0.9344
Lus10009618 18.8 0.9337
AT1G08350 Endomembrane protein 70 protei... Lus10020613 19.7 0.9115

Lus10016130 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.