Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G45020 196 / 4e-66 Ribosomal L18p/L5e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021433 [exp] 241 / 7e-84 AT3G45020 200 / 8e-68 Ribosomal L18p/L5e family protein (.1) Lus10031487 [exp] 51 / 4e-09 AT5G27820 184 / 1e-61 Ribosomal L18p/L5e family protein (.1) Lus10015194 [exp] 51 / 4e-09 AT5G27820 184 / 1e-61 Ribosomal L18p/L5e family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G214400 [exp] 202 / 2e-68 AT3G45020 194 / 2e-65 Ribosomal L18p/L5e family protein (.1) Potri.017G030200 [exp] 41 / 2e-05 AT2G43310 154 / 1e-49 Ribosomal L18p/L5e family protein (.1) Potri.007G128100 [exp] 37 / 0.001 AT2G43310 129 / 1e-39 Ribosomal L18p/L5e family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0267 [flax] [poplar] S11_L18p PF00861 [flax] [poplar] Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Representative CDS sequence Show only first row Show all	>Lus10016132 pacid=23171796 polypeptide=Lus10016132 locus=Lus10016132.g ID=Lus10016132.BGIv1.0 annot-version=v1.0 ATGACTGTGTTGAAGAGGTACGTCCTCAGGCTGTTCATATCACTAAAGTACATAACAGCCAACGTTGTGGACAGGAACAACGGGATGATAGTGGTGACAG CATCAACAGTTGAGCATTCAATCAAAACCAGCCTTGAATGTGGCCGGTCGTGCAACGCCAAAGCAGCAACGGTTGTCGGGGAAGTGTTGGCTATGAGGCT TAAGGTGGAAGGGCTTGAACATGGGTTGGGAAGAGGGATTCATACCAATGTAAACAAAGAGATAGAGAAGAAGGGGTTTAAGAGTAGTACTAAGGTTTGG GCTATTGTCAATGGCCTTAGGAATAATGGTGTTAAACTTATCCTTGATGATGACAATGTTGAAAATGAATCTTAA
AA sequence Show only first row Show all	>Lus10016132 pacid=23171796 polypeptide=Lus10016132 locus=Lus10016132.g ID=Lus10016132.BGIv1.0 annot-version=v1.0 MTVLKRYVLRLFISLKYITANVVDRNNGMIVVTASTVEHSIKTSLECGRSCNAKAATVVGEVLAMRLKVEGLEHGLGRGIHTNVNKEIEKKGFKSSTKVW AIVNGLRNNGVKLILDDDNVENES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G45020			Ribosomal L18p/L5e family prot...		Lus10016132 [exp]	0	1
AT1G03330			Small nuclear ribonucleoprotei...		Lus10029641 [exp]	3.2	0.8883
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10030906 [exp]	4.5	0.8843
AT5G27720		LSM4, EMB1644	SM-like protein 4, embryo defe...		Lus10004221 [exp]	5.5	0.8797
AT5G09260		VPS20.2	vacuolar protein sorting-assoc...		Lus10037699 [exp]	6.0	0.8841
AT4G37000		ATRCCR, ACD2	ARABIDOPSIS THALIANA RED CHLOR...		Lus10019349 [exp]	6.3	0.8378
AT5G57860			Ubiquitin-like superfamily pro...		Lus10035816 [exp]	6.3	0.8547
AT5G27720		LSM4, EMB1644	SM-like protein 4, embryo defe...		Lus10029426 [exp]	9.4	0.8841
AT1G23750			Nucleic acid-binding, OB-fold-...		Lus10029155 [exp]	9.5	0.8523
AT1G66240		ATX1, ATATX1	homolog of anti-oxidant 1 (.1....		Lus10028859 [exp]	11.0	0.8660
AT3G15660		ATGRX4	A. THALIANA GLUTAREDOXIN 4, gl...		Lus10008687 [exp]	12.5	0.8194

Compare expression of checked genes

Lus10016132 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.