Lus10016134 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10016134 pacid=23171855 polypeptide=Lus10016134 locus=Lus10016134.g ID=Lus10016134.BGIv1.0 annot-version=v1.0
ATGCCATTCTGGCTTCTCGGCCGAGTTGATAAAACACATGCGTTGGATGATTATCGGCCACAAAGTTTGAAGGTTAGGCTCAGCCCCTCGTCGGCGCCCG
TTGAGACATCTCAGGCTTCAACTTCGTCAATAGCTTCATCTACGACGCTGGTATCTTCAATGGACATTCTACCGGGATTCGAATTCCAGGTGAGTCGGCT
CGTGGCGCCTCACCCAGCTCCGTAA
AA sequence
>Lus10016134 pacid=23171855 polypeptide=Lus10016134 locus=Lus10016134.g ID=Lus10016134.BGIv1.0 annot-version=v1.0
MPFWLLGRVDKTHALDDYRPQSLKVRLSPSSAPVETSQASTSSIASSTTLVSSMDILPGFEFQVSRLVAPHPAP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10016134 0 1
AT2G35740 ATINT3 nositol transporter 3 (.1) Lus10017559 1.4 0.9239
Lus10024445 3.7 0.9024
Lus10021726 5.9 0.8732
AT3G54200 Late embryogenesis abundant (L... Lus10031555 6.0 0.8869
AT5G55480 GPDL1, GDPDL4, ... glycerophosphodiesterase-like ... Lus10018042 8.7 0.8892
AT3G60330 AHA7 H\(+\)-ATPase 7, H\(+\)-ATPase... Lus10040166 11.0 0.8561
AT1G70520 ASG6, CRK2 ALTERED SEED GERMINATION 6, cy... Lus10010960 12.2 0.8611
Lus10019165 12.5 0.8845
AT4G34390 XLG2 extra-large GTP-binding protei... Lus10009897 13.3 0.8592
AT5G67360 ARA12 Subtilase family protein (.1) Lus10006306 14.3 0.8858

Lus10016134 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.