Lus10016144 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36870 396 / 9e-140 XTH32 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
AT3G44990 393 / 1e-138 AtXTH31, XTH31, ATXTR8, XTR8 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1)
AT1G14720 198 / 1e-61 ATXTH28, EXGT-A2, XTR2 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
AT1G32170 197 / 9e-61 XTH30, XTR4 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
AT1G10550 195 / 1e-60 XTH33, XET xyloglucan:xyloglucosyl transferase 33 (.1)
AT3G25050 194 / 2e-60 XTH3 xyloglucan endotransglucosylase/hydrolase 3 (.1)
AT5G57550 192 / 9e-60 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT4G18990 194 / 2e-59 XTH29, XTR13 xyloglucan endotransglucosylase/hydrolase 29 (.1)
AT2G01850 190 / 2e-58 ATXTH27, EXGT-A3 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
AT5G57560 189 / 2e-58 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021422 530 / 0 AT2G36870 417 / 4e-148 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10041341 472 / 1e-169 AT2G36870 421 / 2e-149 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10037377 467 / 2e-167 AT2G36870 422 / 9e-150 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10023009 372 / 5e-130 AT2G36870 466 / 3e-167 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10026535 370 / 2e-129 AT2G36870 444 / 9e-159 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10001396 370 / 3e-129 AT2G36870 460 / 8e-165 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10013822 367 / 5e-128 AT2G36870 444 / 1e-158 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10026536 322 / 6e-110 AT2G36870 402 / 1e-141 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10013823 244 / 4e-81 AT2G36870 301 / 7e-104 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G006600 405 / 3e-143 AT3G44990 407 / 3e-144 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1)
Potri.006G122900 393 / 2e-138 AT2G36870 478 / 4e-172 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.016G098600 392 / 5e-138 AT2G36870 477 / 1e-171 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.009G163850 211 / 3e-67 AT2G01850 319 / 6e-109 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
Potri.010G102300 200 / 3e-62 AT1G14720 470 / 7e-168 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Potri.008G138400 199 / 8e-62 AT1G14720 467 / 2e-166 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Potri.001G136100 197 / 5e-61 AT1G32170 469 / 6e-167 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.003G097300 196 / 1e-60 AT1G32170 436 / 8e-154 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.006G071200 189 / 1e-58 AT4G25810 379 / 3e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.013G152400 189 / 1e-58 AT4G03210 442 / 2e-158 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10016144 pacid=23171810 polypeptide=Lus10016144 locus=Lus10016144.g ID=Lus10016144.BGIv1.0 annot-version=v1.0
ATGGCTACTACTTCTAATACTACTCGTGTTCTTCTTCCTTCTCTACTACTACCTCTCTTCTTGCTAGCCCAAGTACTCTTTGCTCAAGACTACCCACCCA
ACCCCGGCTACTACCCTAGCTCGAGAGCTCCTTCCATCCCTTTTGATAGAAGGTATCGAAACCGTTGGGGTCCTCAGCACCAGAGGCTCGACCAAAATTT
GCTAACCATCTGGCTAGACCGCTCGTCAGGAAGTGGATACCAATCACTTAAGCCATACAAATCTGGCTACTTTGGTGCTTCCATCAAGCTTCATCCGGGC
TATACGGCTGGAGTCATCACATCTTTCTACCTATCAAACAACGAGGTTCATCCAGGAAATCACGACGAGATCGACATCGAGTTCTTGGGAACCACGCCCG
GGAAGCCATACACATTGCAGACCAATGTGTACGTTAGGGGAAGTGGGGATAGGAACGTTGTAGGCAGAGAAGTGCAGTTCCATCTATGGTTTGATCCCAC
CCAAGACTTCCACCACTATGCAATTTTGTGGGACCCTAATGAAATTATATTTTATGTGGACGATGTGCCAATCAGGAGGTATCCAAAAAAAAGTGAGGAA
ACATTCCCACAAAGACCAATGTGGGTCTACGGATCGATTTGGGATGCATCCGACTGGGCCACTGAGCACGGTAGGTACAGAGCTGACTACAACTACCAAC
CTTTCATTGGCCGGTATAGGGACTTCAAGATCGGTGGCTGCACTGCTTTTGCTAAACCAGAGTGTCAGCCAACACCTGGGTCTCCAACGGGCTACGGAAG
GTTAAGCCAGCAACAAATGGTGTCCATGTCTTGGGTGCAGAGGAACCACATGGTGTATGACTATTGCAATGACCCACAAAGGGACCACACCCACACTCCT
GAGTGCTAG
AA sequence
>Lus10016144 pacid=23171810 polypeptide=Lus10016144 locus=Lus10016144.g ID=Lus10016144.BGIv1.0 annot-version=v1.0
MATTSNTTRVLLPSLLLPLFLLAQVLFAQDYPPNPGYYPSSRAPSIPFDRRYRNRWGPQHQRLDQNLLTIWLDRSSGSGYQSLKPYKSGYFGASIKLHPG
YTAGVITSFYLSNNEVHPGNHDEIDIEFLGTTPGKPYTLQTNVYVRGSGDRNVVGREVQFHLWFDPTQDFHHYAILWDPNEIIFYVDDVPIRRYPKKSEE
TFPQRPMWVYGSIWDASDWATEHGRYRADYNYQPFIGRYRDFKIGGCTAFAKPECQPTPGSPTGYGRLSQQQMVSMSWVQRNHMVYDYCNDPQRDHTHTP
EC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36870 XTH32 xyloglucan endotransglucosylas... Lus10016144 0 1
AT1G24430 HXXXD-type acyl-transferase fa... Lus10035932 6.9 0.9252
AT4G12010 Disease resistance protein (TI... Lus10004075 7.3 0.8986
AT1G05260 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Pe... Lus10015127 13.9 0.9140
AT4G02340 alpha/beta-Hydrolases superfam... Lus10036177 14.3 0.9120
AT1G22440 Zinc-binding alcohol dehydroge... Lus10000624 15.4 0.8528
AT2G16750 Protein kinase protein with ad... Lus10019787 16.2 0.9089
AT1G29970 RPL18AA 60S ribosomal protein L18A-1 (... Lus10005572 17.8 0.8414
AT3G06060 TSC10A TSC10A, NAD(P)-binding Rossman... Lus10010509 18.8 0.9057
AT1G02460 Pectin lyase-like superfamily ... Lus10038059 19.6 0.9042
AT1G17710 AtPEPC1 Arabidopsis thaliana phosphoet... Lus10015634 21.0 0.8968

Lus10016144 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.