Lus10016156 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G45980 186 / 9e-62 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1)
AT3G46030 186 / 1e-61 HTB11 Histone superfamily protein (.1)
AT5G22880 184 / 4e-61 HTB2, H2B HISTONE H2B, histone B2 (.1)
AT1G07790 184 / 6e-61 HTB1 Histone superfamily protein (.1)
AT5G02570 183 / 1e-60 Histone superfamily protein (.1)
AT5G59910 183 / 2e-60 HTB4 Histone superfamily protein (.1)
AT2G28720 182 / 3e-60 Histone superfamily protein (.1)
AT3G53650 181 / 1e-59 Histone superfamily protein (.1)
AT2G37470 179 / 4e-59 Histone superfamily protein (.1)
AT3G09480 167 / 1e-54 Histone superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037371 188 / 2e-62 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1)
Lus10017292 188 / 2e-62 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10041347 187 / 3e-62 AT3G45980 226 / 3e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10040855 187 / 3e-62 AT3G45980 247 / 2e-85 HISTONE H2B, Histone superfamily protein (.1)
Lus10013544 187 / 3e-62 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10017456 186 / 7e-62 AT2G28720 226 / 1e-77 Histone superfamily protein (.1)
Lus10005893 186 / 1e-61 AT3G45980 234 / 8e-81 HISTONE H2B, Histone superfamily protein (.1)
Lus10005897 186 / 1e-61 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1)
Lus10023753 184 / 5e-61 AT2G37470 203 / 7e-69 Histone superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G231300 187 / 3e-62 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.008G030600 187 / 4e-62 AT5G59910 188 / 2e-62 Histone superfamily protein (.1)
Potri.010G230701 186 / 9e-62 AT5G59910 191 / 3e-63 Histone superfamily protein (.1)
Potri.008G030500 186 / 9e-62 AT5G59910 190 / 4e-63 Histone superfamily protein (.1)
Potri.008G030400 186 / 9e-62 AT5G59910 191 / 2e-63 Histone superfamily protein (.1)
Potri.010G230801 186 / 1e-61 AT1G07790 205 / 2e-69 Histone superfamily protein (.1)
Potri.010G230600 186 / 1e-61 AT1G07790 205 / 3e-69 Histone superfamily protein (.1)
Potri.008G029900 186 / 1e-61 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.004G091200 186 / 2e-61 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.009G028001 185 / 2e-61 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Lus10016156 pacid=23171862 polypeptide=Lus10016156 locus=Lus10016156.g ID=Lus10016156.BGIv1.0 annot-version=v1.0
ATGGCACCCAAAGCAGAGAAGAAGCCAGCGGAGAAGAAACCCGCCGAGAAGGCTCCCGTTGCCGAGAAGAAGCCCAGAGCCGAGAAGAAGCTCCCCAAAG
AAGCCGGAGCCGCTGGCGCTGACAAGAAGAAGAAGAAGAACAAGAAGAGCGTCGAGACTTACAAGATCTACATCTTCAAGGTTCTGAAGCAGGTCCACCC
GGACATCGGGATCTCCAGCAAGGCCATGGGGATCATGAACAGCTTCATCAACGACATCTTCGAGAAGCTAGCTGCTGAGTCCTCCAGGCTTGCGAGGTAC
AACAAGAAGCCGACGATTACTTCCAGGGAGATCCAGACTGCTGTGAGGCTTGTTCTTCCAGGGGAGTTGGCGAAGCATGCTGTTTCGGAAGGTACCAAGG
CTGTGACCAAGTTCACCAGCTCTTAG
AA sequence
>Lus10016156 pacid=23171862 polypeptide=Lus10016156 locus=Lus10016156.g ID=Lus10016156.BGIv1.0 annot-version=v1.0
MAPKAEKKPAEKKPAEKAPVAEKKPRAEKKLPKEAGAAGADKKKKKNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAAESSRLARY
NKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10016156 0 1
AT3G27360 Histone superfamily protein (.... Lus10031821 2.0 0.9459
AT5G05180 unknown protein Lus10030507 3.5 0.9085
AT1G47720 OSB1 Organellar Single-stranded, Pr... Lus10014728 3.7 0.8808
AT5G65360 Histone superfamily protein (.... Lus10012744 4.5 0.9329
AT5G23420 HMGB6 high-mobility group box 6 (.1.... Lus10013453 6.2 0.9296
AT3G13275 unknown protein Lus10007090 6.6 0.8655
AT5G41050 Pollen Ole e 1 allergen and ex... Lus10012553 7.9 0.8671
AT4G35150 O-methyltransferase family pro... Lus10025440 7.9 0.8509
AT5G05180 unknown protein Lus10012861 8.0 0.8509
AT1G09200 Histone superfamily protein (.... Lus10031250 8.7 0.9142

Lus10016156 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.