Plant FIBer expression Database

Lus10016159 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27970 147 / 7e-48 CKS2 CDK-subunit 2 (.1)
AT2G27960 145 / 3e-47 CKS1AT, CKS1 cyclin-dependent kinase-subunit 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021405
[exp]
158 / 4e-52 AT2G27970 154 / 1e-50 CDK-subunit 2 (.1)
Lus10041349
[exp]
149 / 3e-48 AT2G27970 154 / 2e-50 CDK-subunit 2 (.1)
Lus10036579
[exp]
84 / 3e-21 AT2G27970 86 / 2e-21 CDK-subunit 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G004000
[exp]
148 / 2e-48 AT2G27960 166 / 2e-55 cyclin-dependent kinase-subunit 1 (.1)
Potri.004G217500
[exp]
145 / 5e-47 AT2G27970 152 / 3e-50 CDK-subunit 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01111 CKS Cyclin-dependent kinase regulatory subunit
Representative CDS sequence
>Lus10016159 pacid=23171861 polypeptide=Lus10016159 locus=Lus10016159.g ID=Lus10016159.BGIv1.0 annot-version=v1.0
ATGGGGCAGATCCAGTACTCTGAGAAGTATTTCGATGACACCTACGAGTACAGGCACGTTGTTCTTACTCCTGAAGTGGCCAAACTGCTCCCCAAGAACC
GCCTCCTCACTGAGAACGAGTGGCGTGCAATCGGGGTTCAACAGAGCCGAGGATGGGTGCACTATGCGATCCACCGTCCGGAGCCACACATCATGCTCTT
CAGGAGGCCTTTGAACTACCAGCAGCAGCAGGAGGCTGCAGCTCAAGCCCAGCAACAAACCATGGTTGCTTAA
AA sequence
>Lus10016159 pacid=23171861 polypeptide=Lus10016159 locus=Lus10016159.g ID=Lus10016159.BGIv1.0 annot-version=v1.0
MGQIQYSEKYFDDTYEYRHVVLTPEVAKLLPKNRLLTENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQEAAAQAQQQTMVA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G27970 CKS2 CDK-subunit 2 (.1) Lus10016159
[exp]
0 1
AT3G46320 Histone superfamily protein (.... Lus10019956
[exp]
3.9 0.9194
AT3G27360 Histone superfamily protein (.... Lus10031252
[exp]
5.1 0.9149
AT5G52220 unknown protein Lus10038870
[exp]
8.4 0.8947
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10005893
[exp]
9.5 0.9096
AT5G10400 Histone superfamily protein (.... Lus10031822
[exp]
14.7 0.9100
AT5G02560 HTA12 histone H2A 12 (.1.2) Lus10040853
[exp]
16.7 0.9137
AT5G37010 unknown protein Lus10031372
[exp]
18.3 0.8987
AT1G07070 Ribosomal protein L35Ae family... Lus10021121
[exp]
19.2 0.8515
AT4G11080 3xHMG-box1 3xHigh Mobility Group-box1, HM... Lus10033951
[exp]
21.0 0.8905
AT5G65360 Histone superfamily protein (.... Lus10025439
[exp]
22.4 0.9015

Lus10016159 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.