Lus10016165 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G10460 52 / 3e-09 Plant self-incompatibility protein S1 family (.1)
AT4G29035 50 / 2e-08 Plant self-incompatibility protein S1 family (.1)
AT3G26880 50 / 2e-08 Plant self-incompatibility protein S1 family (.1)
AT4G16295 49 / 4e-08 SPH1 S-protein homologue 1 (.1)
AT1G11765 47 / 4e-07 Plant self-incompatibility protein S1 family (.1)
AT2G23148 45 / 9e-07 Plant self-incompatibility protein S1 family (.1)
AT5G04350 44 / 2e-06 Plant self-incompatibility protein S1 family (.1)
AT1G28305 44 / 3e-06 Plant self-incompatibility protein S1 family (.1)
AT5G38435 44 / 5e-06 SPH8 S-protein homologue 8 (.1)
AT3G27680 43 / 6e-06 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029376 142 / 2e-44 AT5G38435 52 / 3e-09 S-protein homologue 8 (.1)
Lus10029379 142 / 3e-44 AT5G38435 47 / 2e-07 S-protein homologue 8 (.1)
Lus10029385 141 / 7e-44 AT5G38435 55 / 3e-10 S-protein homologue 8 (.1)
Lus10029384 139 / 3e-43 AT5G38435 51 / 1e-08 S-protein homologue 8 (.1)
Lus10029378 133 / 7e-41 AT5G04350 54 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029381 133 / 9e-41 AT5G04350 54 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029380 130 / 8e-40 AT5G04350 54 / 5e-10 Plant self-incompatibility protein S1 family (.1)
Lus10016168 129 / 2e-39 AT5G38435 51 / 9e-09 S-protein homologue 8 (.1)
Lus10029383 126 / 8e-38 AT5G04350 63 / 6e-13 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 74 / 3e-17 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 57 / 4e-11 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.004G199801 54 / 9e-10 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1)
Potri.004G199700 47 / 2e-07 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.003G175200 43 / 8e-06 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
Potri.001G053300 40 / 9e-05 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
Potri.003G201300 39 / 0.0002 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Potri.006G170200 39 / 0.0002 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10016165 pacid=23142746 polypeptide=Lus10016165 locus=Lus10016165.g ID=Lus10016165.BGIv1.0 annot-version=v1.0
ATGAGATCCGAGATTCTCTCGCTTGCTATCGTGGTAGCAACATTTGTGCTCGCCACAACAATTTTTGCAGCACCGCCTGTTGATTTCAAGAGAACCATAC
ATGTCCACATCATAAACGAGCTTCAGCATAACCAACAGTTGGCCGTGCAGTGTAACTGTACTGACACACGTCGGCCAACCGGCTACGTCAAACCTGGAGC
TGAGTACGAGTGGTCGTTCAAAGAACATTTTCTACGGAAGACTCAATGGTTATGCTATCTCTCTCCGGACAACAATCGTCACGCCAATATTGAAGCCTTT
GTGGACATGACGCCTACTGACAACTACAACGTCTATTGGGCCGTTAAAGAAGACGGCATTTACTTTAGGTTTCCTAATCCTCCTGATTTTCTCACATATA
AATGGGAATCCGGTCGCTAA
AA sequence
>Lus10016165 pacid=23142746 polypeptide=Lus10016165 locus=Lus10016165.g ID=Lus10016165.BGIv1.0 annot-version=v1.0
MRSEILSLAIVVATFVLATTIFAAPPVDFKRTIHVHIINELQHNQQLAVQCNCTDTRRPTGYVKPGAEYEWSFKEHFLRKTQWLCYLSPDNNRHANIEAF
VDMTPTDNYNVYWAVKEDGIYFRFPNPPDFLTYKWESGR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G10460 Plant self-incompatibility pro... Lus10016165 0 1
AT1G24460 TNO1 TGN-localized SYP41 interactin... Lus10009250 1.0 1.0000
Lus10020192 1.4 0.9190
AT5G03860 MLS malate synthase (.1.2) Lus10006282 2.0 0.8413
AT4G23180 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-li... Lus10015092 6.7 0.8797
AT5G59845 Gibberellin-regulated family p... Lus10018708 7.9 0.7142
AT5G28210 mRNA capping enzyme family pro... Lus10040496 11.4 0.7989
AT1G64090 RTNLB3 Reticulan like protein B3 (.1.... Lus10013099 12.2 0.6951
AT3G53180 NodGS nodulin/glutamine synthase-lik... Lus10023904 14.3 0.7742
AT4G11530 CRK34 cysteine-rich RLK (RECEPTOR-li... Lus10022285 15.4 0.7742
Lus10010383 16.5 0.7742

Lus10016165 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.