Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26880 37 / 0.0007 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029376 [exp] 168 / 2e-55 AT5G38435 52 / 3e-09 S-protein homologue 8 (.1) Lus10029378 [exp] 115 / 2e-34 AT5G04350 54 / 1e-09 Plant self-incompatibility protein S1 family (.1) Lus10029377 [exp] 105 / 1e-30 AT4G16295 57 / 8e-11 S-protein homologue 1 (.1) Lus10029380 [exp] 103 / 1e-29 AT5G04350 54 / 5e-10 Plant self-incompatibility protein S1 family (.1) Lus10029384 [exp] 100 / 2e-28 AT5G38435 51 / 1e-08 S-protein homologue 8 (.1) Lus10016165 [exp] 100 / 2e-28 AT3G10460 52 / 2e-09 Plant self-incompatibility protein S1 family (.1) Lus10016168 [exp] 100 / 2e-28 AT5G38435 51 / 9e-09 S-protein homologue 8 (.1) Lus10029379 [exp] 100 / 3e-28 AT5G38435 47 / 2e-07 S-protein homologue 8 (.1) Lus10029383 [exp] 99 / 1e-27 AT5G04350 63 / 6e-13 Plant self-incompatibility protein S1 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G066900 [exp] 40 / 8e-05 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.002G252500 [exp] 39 / 0.0002 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10016167 pacid=23142720 polypeptide=Lus10016167 locus=Lus10016167.g ID=Lus10016167.BGIv1.0 annot-version=v1.0 ATGAACGAGTTTAGCGGGAAGGAGGTGCTGACGGTGCAGTGTAACTGCACCGACAGACCTCAGCCAGTCAATTATGTCAAAGTTGGAATTGAGTACGAGT TGGTGTTCAAGAAACATTGGTTCCGAGACACACAGTGGATTTGTTACTTTTCCCCAAACAACAAACGTCGAGTCAATATCGTAGTCTATCACGTCGGGAT TCTTGATTACAATCACAACATTTTTTGGGCCGTTAAAGAAGACGCCGTTTACACTAGGCACCCTGGCGGAAACGACGAGTTGGATTTTGAATTGCAAACT TTATGA
AA sequence Show only first row Show all	>Lus10016167 pacid=23142720 polypeptide=Lus10016167 locus=Lus10016167.g ID=Lus10016167.BGIv1.0 annot-version=v1.0 MNEFSGKEVLTVQCNCTDRPQPVNYVKVGIEYELVFKKHWFRDTQWICYFSPNNKRRVNIVVYHVGILDYNHNIFWAVKEDAVYTRHPGGNDELDFELQT L

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10016167 [exp]	0	1

Compare expression of checked genes

Lus10016167 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.