Lus10016168 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04350 40 / 9e-05 Plant self-incompatibility protein S1 family (.1)
AT5G38435 40 / 0.0001 SPH8 S-protein homologue 8 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029377 120 / 1e-35 AT4G16295 57 / 8e-11 S-protein homologue 1 (.1)
Lus10029378 118 / 9e-35 AT5G04350 54 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Lus10016165 116 / 5e-34 AT3G10460 52 / 2e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029385 112 / 1e-32 AT5G38435 55 / 3e-10 S-protein homologue 8 (.1)
Lus10029379 110 / 1e-31 AT5G38435 47 / 2e-07 S-protein homologue 8 (.1)
Lus10029381 109 / 2e-31 AT5G04350 54 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029376 108 / 9e-31 AT5G38435 52 / 3e-09 S-protein homologue 8 (.1)
Lus10029383 105 / 1e-29 AT5G04350 63 / 6e-13 Plant self-incompatibility protein S1 family (.1)
Lus10029384 105 / 1e-29 AT5G38435 51 / 1e-08 S-protein homologue 8 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 54 / 2e-09 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 44 / 6e-06 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10016168 pacid=23142651 polypeptide=Lus10016168 locus=Lus10016168.g ID=Lus10016168.BGIv1.0 annot-version=v1.0
ATGACATCTAACAAAATTCTCTCACTTGCTGTCGTGGTAGCAATAGTTGCGCTGGCCGCGACAATTCCTCCATCGTCGGCCAACTGGTTGCACAAGCCAT
TCCGTGTCCACATCTCGAACGAGCTTACCGGGAATGAGGTGTTGTTCGTGCATTGTCACTGTACTGACGGGTACCGGCCAGTCAGCTACATCAATCCCGG
AACTGAGTACGTGTGGCCGTTCAACTTACATTTATTCCGAAAGACACGTTGGACTTGTTACGTTTCCCCGGACAACAATCGCGTGGTCGGTTTCGTAGCC
TATGACGACGGGGTTTATGATGACAATGGTGACGTCTATTGGGCTGTTAAAGAAGACGGCGTTTACTTTAGGTTTCCTGAGACGCCCGACAACTTGCAAT
ATACGTGGGAAACCATTCACTCCGAACTTCTTTGA
AA sequence
>Lus10016168 pacid=23142651 polypeptide=Lus10016168 locus=Lus10016168.g ID=Lus10016168.BGIv1.0 annot-version=v1.0
MTSNKILSLAVVVAIVALAATIPPSSANWLHKPFRVHISNELTGNEVLFVHCHCTDGYRPVSYINPGTEYVWPFNLHLFRKTRWTCYVSPDNNRVVGFVA
YDDGVYDDNGDVYWAVKEDGVYFRFPETPDNLQYTWETIHSELL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G38435 SPH8 S-protein homologue 8 (.1) Lus10016168 0 1
AT4G16195 Plant self-incompatibility pro... Lus10017929 2.0 1.0000
Lus10034545 2.0 1.0000
AT5G67090 Subtilisin-like serine endopep... Lus10002044 2.4 1.0000
AT1G29430 SAUR-like auxin-responsive pro... Lus10007059 2.8 1.0000
AT1G08790 Protein of unknown function (D... Lus10042536 3.2 0.9118
AT1G17615 Disease resistance protein (TI... Lus10018023 3.2 0.8054
AT5G08020 ATRPA70B ARABIDOPSIS THALIANA RPA70-KDA... Lus10042979 4.0 0.8222
Lus10028981 4.9 0.8001
AT3G08720 ATPK2, ATPK19, ... ARABIDOPSIS THALIANA SERINE/TH... Lus10022732 4.9 0.8803
AT5G38435 SPH8 S-protein homologue 8 (.1) Lus10029379 5.3 0.8377

Lus10016168 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.