Lus10016171 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04347 53 / 2e-09 Plant self-incompatibility protein S1 family (.1)
AT4G29035 53 / 3e-09 Plant self-incompatibility protein S1 family (.1)
AT4G16295 51 / 1e-08 SPH1 S-protein homologue 1 (.1)
AT3G10460 47 / 3e-07 Plant self-incompatibility protein S1 family (.1)
AT5G04350 46 / 9e-07 Plant self-incompatibility protein S1 family (.1)
AT4G16195 44 / 6e-06 Plant self-incompatibility protein S1 family (.1)
AT5G38435 43 / 1e-05 SPH8 S-protein homologue 8 (.1)
AT1G26798 42 / 2e-05 Plant self-incompatibility protein S1 family (.1)
AT1G28305 40 / 7e-05 Plant self-incompatibility protein S1 family (.1)
AT1G11765 39 / 0.0002 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029383 113 / 1e-32 AT5G04350 63 / 6e-13 Plant self-incompatibility protein S1 family (.1)
Lus10029375 110 / 1e-31 AT5G04347 62 / 4e-13 Plant self-incompatibility protein S1 family (.1)
Lus10029390 107 / 2e-30 AT4G16295 71 / 5e-16 S-protein homologue 1 (.1)
Lus10016165 107 / 3e-30 AT3G10460 52 / 2e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029388 101 / 4e-28 AT5G04350 55 / 3e-10 Plant self-incompatibility protein S1 family (.1)
Lus10011895 101 / 7e-28 AT4G29035 72 / 3e-16 Plant self-incompatibility protein S1 family (.1)
Lus10029386 100 / 1e-27 AT4G29035 53 / 2e-09 Plant self-incompatibility protein S1 family (.1)
Lus10029379 100 / 2e-27 AT5G38435 47 / 2e-07 S-protein homologue 8 (.1)
Lus10029385 98 / 9e-27 AT5G38435 55 / 3e-10 S-protein homologue 8 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 72 / 2e-16 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 59 / 1e-11 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.006G170200 48 / 1e-07 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
Potri.001G053300 45 / 2e-06 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
Potri.004G199700 44 / 5e-06 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.004G199801 42 / 2e-05 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1)
Potri.001G053200 40 / 8e-05 AT3G24060 56 / 1e-10 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10016171 pacid=23142649 polypeptide=Lus10016171 locus=Lus10016171.g ID=Lus10016171.BGIv1.0 annot-version=v1.0
ATGATGATCACACTACCGTCCCTCACTATCATGGCGGCGGCAGCGGTGGTAACGGTAATTCTGGCGACAATTCCACCATCGTCAGCAGGGTTGTTATCGT
ACTATCATGTCCACATCATCAACGACCTAGACAACGCCGAGTCCTTGTTGGTGCGTTGTCACTGTACCGACCACGAACTGGGAGACCACTACATCGCCCC
CGGTCGCGAATTCGAGTGGAGGTTCAAGGAGCACATATTTAGAAAGACGCTATGGCAGTGCTACGTCTCTCCGACGGACGAAAAACTCCACGTGGATTTC
CACGCCTTCGATGACTTCACGGTCACCTTCGGTAACCACGTGTACTGGATAGTGAAGGAGATCGGCGTCTTCTATCGAGACGCCGATAGTATGAAAGATG
TGTTCATGTACGGATGGCAACATGGCCGGCTTCCTGTGTCATGA
AA sequence
>Lus10016171 pacid=23142649 polypeptide=Lus10016171 locus=Lus10016171.g ID=Lus10016171.BGIv1.0 annot-version=v1.0
MMITLPSLTIMAAAAVVTVILATIPPSSAGLLSYYHVHIINDLDNAESLLVRCHCTDHELGDHYIAPGREFEWRFKEHIFRKTLWQCYVSPTDEKLHVDF
HAFDDFTVTFGNHVYWIVKEIGVFYRDADSMKDVFMYGWQHGRLPVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G04347 Plant self-incompatibility pro... Lus10016171 0 1
Lus10030050 3.6 0.8242
AT5G26594 ARR24 response regulator 24 (.1) Lus10004775 4.8 0.8672
AT3G12750 ZIP1 zinc transporter 1 precursor (... Lus10019853 6.8 0.8672
AT3G07040 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRI... Lus10026765 8.3 0.8672
AT3G03450 GRAS RGL2 RGA-like 2 (.1) Lus10036457 9.6 0.8672
AT4G15610 Uncharacterised protein family... Lus10033972 10.7 0.8583
AT5G41040 HXXXD-type acyl-transferase fa... Lus10039329 10.7 0.8672
AT5G38760 Late embryogenesis abundant pr... Lus10012179 12.0 0.8399
AT3G57530 ATCPK32, CDPK32... calcium-dependent protein kina... Lus10042370 12.4 0.8551
AT4G13250 NYC1, NYC NON-YELLOW COLORING 1, NAD(P)-... Lus10034917 13.6 0.8550

Lus10016171 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.