Lus10016187 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G09790 172 / 6e-53 COBL6 COBRA-like protein 6 precursor (.1)
AT3G02210 159 / 1e-47 COBL1 COBRA-like protein 1 precursor (.1)
AT3G29810 150 / 2e-44 COBL2 COBRA-like protein 2 precursor (.1)
AT5G15630 148 / 7e-44 IRX6, COBL4 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1)
AT5G60920 147 / 3e-43 COB COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029360 227 / 5e-74 AT1G09790 499 / 7e-176 COBRA-like protein 6 precursor (.1)
Lus10007217 192 / 2e-60 AT1G09790 471 / 1e-164 COBRA-like protein 6 precursor (.1)
Lus10034666 157 / 3e-47 AT5G15630 627 / 0.0 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1)
Lus10017866 155 / 3e-46 AT5G15630 625 / 0.0 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1)
Lus10012598 154 / 8e-46 AT3G02210 697 / 0.0 COBRA-like protein 1 precursor (.1)
Lus10034379 153 / 1e-45 AT3G02210 685 / 0.0 COBRA-like protein 1 precursor (.1)
Lus10017863 152 / 6e-45 AT5G15630 717 / 0.0 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1)
Lus10034670 151 / 8e-45 AT5G15630 715 / 0.0 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1)
Lus10035131 147 / 3e-43 AT5G15630 704 / 0.0 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G219200 180 / 6e-56 AT1G09790 511 / 2e-180 COBRA-like protein 6 precursor (.1)
Potri.004G117100 153 / 1e-45 AT3G02210 724 / 0.0 COBRA-like protein 1 precursor (.1)
Potri.015G060200 153 / 2e-45 AT5G15630 669 / 0.0 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1)
Potri.015G060100 150 / 2e-44 AT5G15630 739 / 0.0 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1)
Potri.004G117200 149 / 3e-44 AT5G15630 679 / 0.0 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1)
Potri.015G060000 142 / 3e-41 AT5G60920 759 / 0.0 COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1)
Potri.017G098600 135 / 5e-39 AT5G60920 601 / 0.0 COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1)
Potri.012G062200 130 / 4e-37 AT5G15630 586 / 0.0 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1)
Potri.017G098700 127 / 5e-36 AT5G60920 614 / 0.0 COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1)
Potri.004G167100 112 / 4e-30 AT3G29810 407 / 2e-139 COBRA-like protein 2 precursor (.1)
PFAM info
Representative CDS sequence
>Lus10016187 pacid=23142663 polypeptide=Lus10016187 locus=Lus10016187.g ID=Lus10016187.BGIv1.0 annot-version=v1.0
ATGAAGAACTACTCTCAGTGGAACTTAGTAATCTTGCACCCGAATTTGAAGAACATCACTCAAGTGTTCAGCTTTAACTATGCCCCCCTCGACAAGTTTC
GCTACACCAATGACAGTGGGATGTTCTGGGGTGTGAAATTCTACAACGACGTGCTGTTGCAAGAAGGGGAGAGCGGGAATGTTCAGAGCGAGATGCTGCT
GGCGAAAGAGGCAGGGATTTTTAGTTTCAGGGAAGGATGGGCTTTTCCGAGGAGGATTTTGTTCAATGGAGATGAATGTGTAATGCCATCTCCAGATAAC
TATCCAAGGCTCCCAAATACATCTCCTCCACTAATTTCCTCTTCCATTCTGTCCTTAATCTCCATTTTTCTCTTCTTCTGCTTCTTGATCGATTGA
AA sequence
>Lus10016187 pacid=23142663 polypeptide=Lus10016187 locus=Lus10016187.g ID=Lus10016187.BGIv1.0 annot-version=v1.0
MKNYSQWNLVILHPNLKNITQVFSFNYAPLDKFRYTNDSGMFWGVKFYNDVLLQEGESGNVQSEMLLAKEAGIFSFREGWAFPRRILFNGDECVMPSPDN
YPRLPNTSPPLISSSILSLISIFLFFCFLID

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G09790 COBL6 COBRA-like protein 6 precursor... Lus10016187 0 1
AT1G03220 Eukaryotic aspartyl protease f... Lus10041226 1.0 0.8681
AT2G30300 Major facilitator superfamily ... Lus10015470 4.5 0.7946
Lus10027544 7.7 0.7570
AT1G60590 Pectin lyase-like superfamily ... Lus10030604 16.3 0.7765
AT2G48020 Major facilitator superfamily ... Lus10027977 19.5 0.8551
AT1G03890 RmlC-like cupins superfamily p... Lus10003554 25.0 0.8041
AT5G25610 ATRD22, RD22 RESPONSIVE TO DESSICATION 22, ... Lus10003263 26.2 0.6873
AT1G10522 unknown protein Lus10030652 31.5 0.6728
Lus10014949 32.7 0.8034
AT1G08590 Leucine-rich receptor-like pro... Lus10002754 39.5 0.7440

Lus10016187 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.