Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52360 59 / 2e-12 unknown protein AT2G35850 54 / 1e-10 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029348 [exp] 194 / 1e-65 AT3G52360 55 / 5e-11 unknown protein Lus10021242 [exp] 49 / 1e-08 ND 38 / 1e-04 Lus10013609 [exp] 49 / 2e-08 ND 37 / 3e-04
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G066200 [exp] 77 / 2e-19 AT3G52360 88 / 3e-24 unknown protein Potri.006G200000 [exp] 71 / 2e-17 AT3G52360 89 / 9e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016198 pacid=23142745 polypeptide=Lus10016198 locus=Lus10016198.g ID=Lus10016198.BGIv1.0 annot-version=v1.0 ATGGAGAATTCAATGGGGGTTGGTCTAATGGCTGCATTCGCAGTCTCCGGTAGCGTGGTTCTCATCTCAACCCAGTTCCACAAACGCCTCGTCTCCAATT TCATGGACAAGATCGAGACCGAAATCGGGGGGAGAAGGAGGGTGAGGGGAATTCATAATCACGAGAAGAAGCAGAGGAAGATGAAGAGGGTTCGATTCGC GGAGGATGTTACGGAGCTTTCCCCTATTTCGGATGAACTTTTCGACGAGGATGATGAGGAGGAAGAAGAGATACTGGGAGGGATGCCTGTGAATCGGCAG ATTCTGTACAAAGGGATTATGGATTATCGGACTATGAAGGACTACCACATTTCCACTTGCATCTAA
AA sequence Show only first row Show all	>Lus10016198 pacid=23142745 polypeptide=Lus10016198 locus=Lus10016198.g ID=Lus10016198.BGIv1.0 annot-version=v1.0 MENSMGVGLMAAFAVSGSVVLISTQFHKRLVSNFMDKIETEIGGRRRVRGIHNHEKKQRKMKRVRFAEDVTELSPISDELFDEDDEEEEEILGGMPVNRQ ILYKGIMDYRTMKDYHISTCI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G52360			unknown protein		Lus10016198 [exp]	0	1
					Lus10016106 [exp]	3.2	0.8039
AT3G08860		PYD4	PYRIMIDINE 4 (.1)		Lus10009086 [exp]	4.7	0.8149
AT4G35750			SEC14 cytosolic factor family ...		Lus10028388 [exp]	7.3	0.7927
AT3G48660			Protein of unknown function (D...		Lus10015769 [exp]	7.5	0.7918
AT3G53010			Domain of unknown function (DU...		Lus10042636 [exp]	9.4	0.6967
AT5G05960			Bifunctional inhibitor/lipid-t...		Lus10000397 [exp]	12.6	0.7905
AT4G35750			SEC14 cytosolic factor family ...		Lus10041841 [exp]	27.6	0.7577
AT5G46600			Aluminium activated malate tra...		Lus10042571 [exp]	33.9	0.7458
AT5G14280	GeBP		DNA-binding storekeeper protei...		Lus10036981 [exp]	37.1	0.7285
AT1G73210			Protein of unknown function (D...		Lus10038327 [exp]	37.3	0.7132

Compare expression of checked genes

Lus10016198 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.