Lus10016217 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G03220 259 / 1e-89 Mediator complex, subunit Med7 (.1)
AT5G03500 254 / 5e-88 Mediator complex, subunit Med7 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029326 304 / 2e-107 AT5G03500 267 / 7e-93 Mediator complex, subunit Med7 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G062800 276 / 2e-96 AT5G03220 249 / 5e-86 Mediator complex, subunit Med7 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05983 Med7 MED7 protein
Representative CDS sequence
>Lus10016217 pacid=23142640 polypeptide=Lus10016217 locus=Lus10016217.g ID=Lus10016217.BGIv1.0 annot-version=v1.0
ATGGCGACAGCTACATATCCACCTCCTCCGCCGTATTACAGACTGTACAAAGATTACTTGCAGAATCCCAAATCCGCGCCTGAGCCTCCTCCTCCAGTTG
AAGGAACGTACGTCTGCTATGGAGGCAATTACACTACTGATGATGTTCTTCCAAGCTTGGAAGATCAGGGAGTGCGTCAGCTGTACCCTAAGGGACCTAA
TGTTGATTTCAAGAAGGAACTGAGATCACTAAACAGAGAATTGCAGCTGCACATTTTAGAGCTTGCTGATGTTCTTGTCGAGAGACCATCACAGTACGCT
CGGAGAGTGGAAGACATATCCCTTATCTTTAAGAATTTGCACCACCTTCTTAATTCATTGCGGCCCCATCAGGCTAGAGCCACGTTAATTCACATTCTGG
AGCTTCAGATTGAACGACGCAAACAAGCTGTGGAGGATATTAAAAGGAGGAGAGAAGAAGCACAGAAGCTTCTCAGGGAAGCTGTTGAATCATTAGATGG
ACAGTAG
AA sequence
>Lus10016217 pacid=23142640 polypeptide=Lus10016217 locus=Lus10016217.g ID=Lus10016217.BGIv1.0 annot-version=v1.0
MATATYPPPPPYYRLYKDYLQNPKSAPEPPPPVEGTYVCYGGNYTTDDVLPSLEDQGVRQLYPKGPNVDFKKELRSLNRELQLHILELADVLVERPSQYA
RRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIERRKQAVEDIKRRREEAQKLLREAVESLDGQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G03500 Mediator complex, subunit Med7... Lus10016217 0 1
AT1G21320 nucleotide binding;nucleic aci... Lus10028599 7.1 0.7441
AT3G50620 P-loop containing nucleoside t... Lus10009348 9.7 0.8169
AT1G58100 TCP TCP8 TCP domain protein 8, TCP fami... Lus10019949 10.6 0.7797
AT1G50660 unknown protein Lus10043111 10.7 0.7896
AT1G25580 NAC ANAC008, SOG1 SUPPRESSOR OF GAMMA RADIATION ... Lus10021708 16.1 0.7666
AT3G07170 Sterile alpha motif (SAM) doma... Lus10022780 20.5 0.7943
AT1G62520 unknown protein Lus10032250 26.0 0.6817
AT3G13960 GRF ATGRF5 growth-regulating factor 5 (.1... Lus10000468 27.7 0.7698
AT4G34880 Amidase family protein (.1) Lus10002804 34.7 0.7870
AT5G20510 Alfin AL5 alfin-like 5 (.1) Lus10015637 38.0 0.7645

Lus10016217 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.