Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G45330 51 / 1e-08 Concanavalin A-like lectin protein kinase family protein (.1) AT3G45410 51 / 1e-08 Concanavalin A-like lectin protein kinase family protein (.1) AT4G02420 51 / 2e-08 Concanavalin A-like lectin protein kinase family protein (.1) AT5G60280 49 / 1e-07 Concanavalin A-like lectin protein kinase family protein (.1) AT2G37710 49 / 1e-07 RLK receptor lectin kinase (.1) AT3G45430 49 / 1e-07 Concanavalin A-like lectin protein kinase family protein (.1) AT4G02410 47 / 3e-07 Concanavalin A-like lectin protein kinase family protein (.1) AT3G45440 44 / 5e-06 Concanavalin A-like lectin protein kinase family protein (.1) AT5G60320 44 / 6e-06 Concanavalin A-like lectin protein kinase family protein (.1) AT3G45420 44 / 7e-06 Concanavalin A-like lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029315 [exp] 126 / 7e-35 AT3G53810 758 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10008597 [exp] 114 / 1e-30 AT3G53810 771 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10035627 [exp] 110 / 2e-29 AT2G37710 755 / 0.0 receptor lectin kinase (.1) Lus10003224 [exp] 107 / 3e-28 AT3G53810 781 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10024365 [exp] 54 / 1e-09 AT3G55550 711 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10001562 [exp] 53 / 4e-09 AT3G53810 655 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10004982 [exp] 53 / 4e-09 AT3G53810 664 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10010867 [exp] 51 / 2e-08 AT3G55550 714 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10042217 [exp] 47 / 4e-07 AT1G06890 201 / 1e-61 nodulin MtN21 /EamA-like transporter family protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G088400 [exp] 78 / 4e-18 AT2G37710 800 / 0.0 receptor lectin kinase (.1) Potri.006G088801 [exp] 78 / 4e-18 AT3G53810 662 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.006G088632 [exp] 78 / 5e-18 AT2G37710 770 / 0.0 receptor lectin kinase (.1) Potri.006G088900 [exp] 77 / 8e-18 AT2G37710 801 / 0.0 receptor lectin kinase (.1) Potri.006G088648 [exp] 73 / 3e-16 AT2G37710 710 / 0.0 receptor lectin kinase (.1) Potri.006G088600 [exp] 73 / 3e-16 AT2G37710 808 / 0.0 receptor lectin kinase (.1) Potri.006G088680 [exp] 73 / 3e-16 AT2G37710 787 / 0.0 receptor lectin kinase (.1) Potri.016G101000 [exp] 57 / 1e-10 AT3G55550 704 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.008G058400 [exp] 54 / 2e-09 AT3G55550 714 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.010G200600 [exp] 49 / 8e-08 AT3G55550 707 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [flax] [poplar] Concanavalin PF00139 [flax] [poplar] Lectin_legB Legume lectin domain
Representative CDS sequence Show only first row Show all	>Lus10016226 pacid=23142748 polypeptide=Lus10016226 locus=Lus10016226.g ID=Lus10016226.BGIv1.0 annot-version=v1.0 ATGGTCATGTCCCCGAAACGACTCGCCGTCGTCCTACTAATAACATCAGTACTCGTATCATCATCCTCCTCAAACGACGACGTTGGTTTCACACACAACC GCTTCCCGGCGAAGAACCTTGTACTCGACGGCACAGCAGAGTACACTTCAGACAACCTTCTCCGGCTCACCAACAACACATTCCAGCGACAAGGCCACGC CTTTTATCCACGCCCGGTAACGTTCAAAAATAACAATCCAAATGGTACCGTTTCGTCCTTCTCCACTTCCTTTGTCGTCGCAATTGTACCACGGCACTCG AACCCGGGAGGCCACAGGATGCCGTCGTGA
AA sequence Show only first row Show all	>Lus10016226 pacid=23142748 polypeptide=Lus10016226 locus=Lus10016226.g ID=Lus10016226.BGIv1.0 annot-version=v1.0 MVMSPKRLAVVLLITSVLVSSSSSNDDVGFTHNRFPAKNLVLDGTAEYTSDNLLRLTNNTFQRQGHAFYPRPVTFKNNNPNGTVSSFSTSFVVAIVPRHS NPGGHRMPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G02420			Concanavalin A-like lectin pro...		Lus10016226 [exp]	0	1
AT4G23410		TET5	tetraspanin5 (.1)		Lus10036518 [exp]	1.7	0.8439
AT5G38420			Ribulose bisphosphate carboxyl...		Lus10005093 [exp]	6.3	0.7791
AT3G28345		MDR13, ABCB15	multi-drug resistance 13, ATP-...		Lus10034967 [exp]	12.2	0.7554
					Lus10010548 [exp]	14.3	0.7398
					Lus10006254 [exp]	21.6	0.7247
AT1G35670		CPK11, ATCDPK2,...	calcium-dependent protein kina...		Lus10006065 [exp]	21.8	0.7341
AT4G23160		CRK8	cysteine-rich RLK (RECEPTOR-li...		Lus10031577 [exp]	24.9	0.7231
					Lus10010828 [exp]	26.4	0.7402
AT5G03810			GDSL-like Lipase/Acylhydrolase...		Lus10035585 [exp]	35.4	0.7287
AT1G60370			F-box and associated interacti...		Lus10008162 [exp]	35.4	0.6887

Compare expression of checked genes

Lus10016226 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.