Lus10016231 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G65870 146 / 1e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 145 / 2e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 140 / 3e-42 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13650 137 / 2e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 137 / 2e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13660 134 / 1e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 134 / 4e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 134 / 7e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT1G22900 129 / 5e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13662 125 / 2e-36 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029312 241 / 2e-82 AT3G13660 135 / 1e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10018340 180 / 4e-58 AT1G58170 129 / 3e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10000376 171 / 2e-55 AT5G42510 87 / 1e-22 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10029306 149 / 8e-46 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10042488 145 / 4e-44 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10026176 144 / 7e-44 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10030483 141 / 1e-42 AT1G65870 164 / 1e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10021084 130 / 4e-38 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10039561 129 / 5e-38 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G216300 158 / 3e-49 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.003G216400 157 / 7e-49 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 154 / 7e-48 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216200 154 / 9e-48 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.001G009100 152 / 5e-47 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060900 144 / 6e-44 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.006G195300 144 / 1e-43 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060700 136 / 1e-40 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060801 133 / 6e-40 AT1G58170 164 / 5e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.009G131000 129 / 5e-38 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10016231 pacid=23142658 polypeptide=Lus10016231 locus=Lus10016231.g ID=Lus10016231.BGIv1.0 annot-version=v1.0
ATGGCTCACAACCCATCTCTCCTTCTTATCATTGCCATACTCACCATCAACATCATAACAATATCTCCCTCGTCAATCAACATCGACATCAACAACTCAA
CAATAAAGCAAACCCACATCAACCTCTACTGGCACAACAACGCCAACGCCACCTCCCCCAACGTCACCGACGTCCTCTCCGTCCCTCCTGCCTTGCCCAA
CTCCCCCGTCGGTTTCGGGGCCATAAGCGTCTTCGACGATCCTCTCACCGCTGGTCCCAGCCCTGGCTCGCACTTGCTGGGCAGAGCTCAGGGCTCCTAC
GTGTCTGCTTCTCATCAGACGTTCGGGATTATGATGGCGATGAACTTAGTGTTCATGGGCGGTAAGTTCAACGGAAGCAGCCTCGCCGTGATGGGAAGGA
ATGAAGTGCCGTTGAAGGTTCGAGAGTTGCCGGTGATCGGAGGGACTGGAGTTTTCCGGCTGGCTAGGGGCTATGTTATTATGAATACGTACTTCTTTGA
CCCTAAAGCTGGGCTTGCCGTGGTTGAGTATAATATCTACGTTTGGCATTATTAG
AA sequence
>Lus10016231 pacid=23142658 polypeptide=Lus10016231 locus=Lus10016231.g ID=Lus10016231.BGIv1.0 annot-version=v1.0
MAHNPSLLLIIAILTINIITISPSSINIDINNSTIKQTHINLYWHNNANATSPNVTDVLSVPPALPNSPVGFGAISVFDDPLTAGPSPGSHLLGRAQGSY
VSASHQTFGIMMAMNLVFMGGKFNGSSLAVMGRNEVPLKVRELPVIGGTGVFRLARGYVIMNTYFFDPKAGLAVVEYNIYVWHY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G65870 Disease resistance-responsive ... Lus10016231 0 1
AT5G53950 NAC ATCUC2, CUC2, A... CUP-SHAPED COTYLEDON 2, Arabid... Lus10005537 1.0 0.9973
Lus10016534 2.6 0.9918
Lus10041871 3.2 0.9927
Lus10026293 3.7 0.9949
AT3G05600 alpha/beta-Hydrolases superfam... Lus10029878 3.9 0.9942
AT5G14070 ROXY2 Thioredoxin superfamily protei... Lus10011333 4.5 0.9898
AT2G35160 SGD9, SUVH5 SET DOMAIN-CONTAINING PROTEIN ... Lus10043211 4.5 0.9942
AT5G45980 HD WOX9B, STPL, WO... WUSCHEL related homeobox 9B, S... Lus10013960 6.5 0.9923
AT1G44760 Adenine nucleotide alpha hydro... Lus10042701 7.3 0.9791
AT2G17950 HD WUS1, PGA6, WUS WUSCHEL 1, WUSCHEL, Homeodomai... Lus10041909 7.5 0.9916

Lus10016231 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.