Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11930 71 / 1e-16 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G58450 71 / 1e-16 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G09740 57 / 3e-11 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT2G47710 50 / 5e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G01520 49 / 2e-08 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G14680 48 / 5e-08 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G53990 47 / 7e-08 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G68300 47 / 1e-07 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G62550 47 / 1e-07 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G03270 42 / 4e-06 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029310 [exp] 92 / 2e-24 AT3G11930 197 / 2e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10009272 [exp] 53 / 8e-10 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10006701 [exp] 51 / 3e-09 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10041436 [exp] 51 / 3e-09 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10025033 [exp] 51 / 4e-09 AT3G62550 186 / 1e-60 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10034337 [exp] 51 / 4e-09 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10010013 [exp] 51 / 5e-09 AT3G62550 184 / 9e-60 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029849 [exp] 51 / 8e-09 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10007043 [exp] 50 / 8e-09 AT2G47710 214 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G064000 [exp] 72 / 5e-17 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.006G198200 [exp] 71 / 2e-16 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.010G123400 [exp] 53 / 5e-10 AT1G68300 115 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.005G015200 [exp] 52 / 1e-09 AT3G62550 156 / 4e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.014G130100 [exp] 50 / 4e-09 AT2G47710 234 / 4e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G009800 [exp] 50 / 7e-09 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G104700 [exp] 50 / 8e-09 AT1G09740 251 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123200 [exp] 49 / 1e-08 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G205275 [exp] 49 / 2e-08 AT2G47710 226 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G193800 [exp] 49 / 2e-08 AT2G47710 213 / 1e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10016233 pacid=23142731 polypeptide=Lus10016233 locus=Lus10016233.g ID=Lus10016233.BGIv1.0 annot-version=v1.0 ATGAAAGCAGCCGCGGCTGAGAATTCGGCGGCGCTATTGGCCAGAGCCATGAAACTCAGCACACGGCAAGTTAATGGAGACGACGGCCATGATGTCGGGG CAGCAGCAGAGGAGGGTATTGGAAGCCGCGGCTTAAGCAAAATCAAAAGAGCGTTTCTGGGGAGCGTGAGTGATTTCTGCGCACACCATGCGAAGTGTCC GGTCCTCATCGTCAAGCCCAACCCTGCAGACAATCAGACTAGCACCACCACCACCGGAGGAGCTCGGCATTAA
AA sequence Show only first row Show all	>Lus10016233 pacid=23142731 polypeptide=Lus10016233 locus=Lus10016233.g ID=Lus10016233.BGIv1.0 annot-version=v1.0 MKAAAAENSAALLARAMKLSTRQVNGDDGHDVGAAAEEGIGSRGLSKIKRAFLGSVSDFCAHHAKCPVLIVKPNPADNQTSTTTTGGARH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G11930			Adenine nucleotide alpha hydro...		Lus10016233 [exp]	0	1

Compare expression of checked genes

Lus10016233 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.