Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G58170 147 / 6e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49040 144 / 8e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13660 137 / 9e-43 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G65870 135 / 2e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G55210 134 / 6e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) AT3G13650 134 / 1e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT2G21100 132 / 3e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G58090 131 / 5e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13662 121 / 3e-36 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42500 114 / 3e-33 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029306 [exp] 202 / 2e-67 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10017231 [exp] 152 / 8e-48 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10026176 [exp] 149 / 6e-47 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10042488 [exp] 148 / 2e-46 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10021084 [exp] 130 / 2e-39 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034476 [exp] 127 / 7e-38 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025067 [exp] 124 / 1e-36 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10039561 [exp] 123 / 1e-36 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10016231 [exp] 121 / 9e-36 AT1G65870 149 / 8e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G195300 [exp] 169 / 2e-54 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G061000 [exp] 165 / 5e-53 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G009100 [exp] 163 / 3e-52 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216400 [exp] 161 / 2e-51 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216200 [exp] 160 / 3e-51 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.016G060900 [exp] 160 / 4e-51 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216300 [exp] 158 / 3e-50 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.016G060801 [exp] 157 / 3e-50 AT1G58170 164 / 5e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060700 [exp] 156 / 1e-49 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.009G131000 [exp] 140 / 1e-43 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [flax] [poplar] AOC_barrel PF03018 [flax] [poplar] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Lus10016237 pacid=23142723 polypeptide=Lus10016237 locus=Lus10016237.g ID=Lus10016237.BGIv1.0 annot-version=v1.0 ATGGCCAAATACTCTCTCCTCTTTCTCCTCCTCCTCACCTCAGCCCTCTCCTCCACCATCTCCGCCGCGCCGGAGCGCACTTCCAAGCTGGTGGGCCGGG CTCAGGGGATTTACGGTTCGGCCTCACAATCCGAGGTGGGCCTGCTGATGGCGCTTAATTTCGCGTTTGTGGAAGGGAAGTATAACGGGAGCACGCTGAG CGTTCTGGGGAGGAACGCCGTGATGTCGCCGGTGAGGGAGATGCCAGTGATTGGCGGGAGCGGGGTTTTCCGGTTCGCTAGAGGGTATGCTAAGGCAAAG ACTAGGGTTTATGATGTTAAGACCGGGGATGCTGTTGTTGAGTATAATGTCTATGTGTTCCATTATTGA
AA sequence Show only first row Show all	>Lus10016237 pacid=23142723 polypeptide=Lus10016237 locus=Lus10016237.g ID=Lus10016237.BGIv1.0 annot-version=v1.0 MAKYSLLFLLLLTSALSSTISAAPERTSKLVGRAQGIYGSASQSEVGLLMALNFAFVEGKYNGSTLSVLGRNAVMSPVREMPVIGGSGVFRFARGYAKAK TRVYDVKTGDAVVEYNVYVFHY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G58170			Disease resistance-responsive ...		Lus10016237 [exp]	0	1
AT5G15890		TBL21	TRICHOME BIREFRINGENCE-LIKE 21...		Lus10034087 [exp]	7.5	0.7633
AT5G45160			Root hair defective 3 GTP-bind...		Lus10018281 [exp]	12.2	0.6937
AT2G17420		NTR2, ATNTRA, N...	NADPH-DEPENDENT THIOREDOXIN RE...		Lus10037596 [exp]	13.3	0.7608
AT3G18215			Protein of unknown function, D...		Lus10009010 [exp]	13.5	0.7571
AT2G13100		AtG3Pp5	glycerol-3-phosphate permease ...		Lus10040002 [exp]	17.9	0.7530
AT1G09960		ATSUC4, SUC4, A...	sucrose transporter 4 (.1)		Lus10032815 [exp]	26.2	0.7390
AT1G58330		ZW2	transcription factor-related (...		Lus10025265 [exp]	27.6	0.7050
AT1G57680			unknown protein		Lus10008842 [exp]	28.3	0.7266
AT5G08530		CI51	51 kDa subunit of complex I (....		Lus10015807 [exp]	28.9	0.7465
AT2G36780			UDP-Glycosyltransferase superf...		Lus10023939 [exp]	31.9	0.7337

Compare expression of checked genes

Lus10016237 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.