Lus10016241 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G09690 295 / 4e-104 Translation protein SH3-like family protein (.1)
AT1G09590 295 / 4e-104 Translation protein SH3-like family protein (.1)
AT1G57860 291 / 2e-102 Translation protein SH3-like family protein (.1)
AT1G57660 291 / 2e-102 Translation protein SH3-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029302 333 / 3e-119 AT1G09690 294 / 1e-103 Translation protein SH3-like family protein (.1)
Lus10030607 323 / 2e-115 AT1G09590 295 / 4e-104 Translation protein SH3-like family protein (.1)
Lus10030882 322 / 7e-115 AT1G09690 296 / 2e-104 Translation protein SH3-like family protein (.1)
Lus10021079 303 / 3e-107 AT1G09590 292 / 6e-103 Translation protein SH3-like family protein (.1)
Lus10017232 303 / 3e-107 AT1G09590 292 / 6e-103 Translation protein SH3-like family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G195400 306 / 2e-108 AT1G57860 305 / 5e-108 Translation protein SH3-like family protein (.1)
Potri.016G061100 304 / 1e-107 AT1G57860 305 / 7e-108 Translation protein SH3-like family protein (.1)
Potri.003G159500 299 / 1e-105 AT1G09690 305 / 4e-108 Translation protein SH3-like family protein (.1)
Potri.001G071100 293 / 1e-103 AT1G09690 307 / 7e-109 Translation protein SH3-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF01157 Ribosomal_L21e Ribosomal protein L21e
Representative CDS sequence
>Lus10016241 pacid=23142750 polypeptide=Lus10016241 locus=Lus10016241.g ID=Lus10016241.BGIv1.0 annot-version=v1.0
ATGCCTGCCGGTCACGGTCTCCGCTCCCGTACTAGGGATCTCTTCTCCCGGCCGTTCAGGAAGCGGGGTTACATCCCTCTGACCACCTACCTCCGTACCT
ACAAGGTCGGCGACTACGTCGACGTCAAGGTCAATGGCGCCATCCACAAAGGTATGCCTCACAAGTTCTACCACGGACGCACCGGGCGCGTGTGGAACGT
CACCAAGCGCGCCATCGGCGTCGAGATGAACAAGCAGGTGAGGGGCAAGATCCTGAAGAAAAGGATCCACGTCAGGATCGAGCATGTGATCCCCTCAAGG
TGCACTGAGGACTTGCAGATCAGGAAGAAGAAGAATGACGAGCTGAAGGCAGCAGCCAAGGCCAGAGGCGAAGTCATTAGCACCAAGAGGCAGCCCCAAG
GACCGAAACCCGGTTTCATGGTGGAGGGTGCTACGCTCGAAACCGTTACTCCCATTCCCTACGATGTCACTAATGACCTTAAGGGCGGGTACTAG
AA sequence
>Lus10016241 pacid=23142750 polypeptide=Lus10016241 locus=Lus10016241.g ID=Lus10016241.BGIv1.0 annot-version=v1.0
MPAGHGLRSRTRDLFSRPFRKRGYIPLTTYLRTYKVGDYVDVKVNGAIHKGMPHKFYHGRTGRVWNVTKRAIGVEMNKQVRGKILKKRIHVRIEHVIPSR
CTEDLQIRKKKNDELKAAAKARGEVISTKRQPQGPKPGFMVEGATLETVTPIPYDVTNDLKGGY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G09590 Translation protein SH3-like f... Lus10016241 0 1
AT3G53740 Ribosomal protein L36e family ... Lus10025342 3.2 0.9065
AT5G60670 Ribosomal protein L11 family p... Lus10023186 3.2 0.9064
AT3G25230 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rota... Lus10002338 5.5 0.8932
AT5G48760 Ribosomal protein L13 family p... Lus10011857 6.3 0.9029
AT1G09830 Glycinamide ribonucleotide (GA... Lus10013696 7.7 0.8707
AT3G57490 Ribosomal protein S5 family pr... Lus10009952 9.6 0.9035
AT1G09690 Translation protein SH3-like f... Lus10030882 10.0 0.8792
AT3G02080 Ribosomal protein S19e family ... Lus10030702 11.4 0.8700
AT2G42740 RPL16A ribosomal protein large subuni... Lus10029824 11.7 0.8895
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Lus10020794 13.0 0.8867

Lus10016241 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.