Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G58060 118 / 3e-33 Cation efflux family protein (.1) AT1G16310 96 / 5e-25 Cation efflux family protein (.1) AT1G79520 96 / 7e-25 Cation efflux family protein (.1.2) AT2G39450 77 / 5e-18 ATMTP11 Cation efflux family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016239 [exp] 144 / 4e-43 AT3G58060 574 / 0.0 Cation efflux family protein (.1) Lus10029304 [exp] 142 / 1e-42 AT3G58060 577 / 0.0 Cation efflux family protein (.1) Lus10009598 [exp] 100 / 2e-26 AT1G16310 518 / 0.0 Cation efflux family protein (.1) Lus10001768 [exp] 97 / 3e-25 AT1G16310 521 / 0.0 Cation efflux family protein (.1) Lus10040318 [exp] 82 / 5e-20 AT2G39450 587 / 0.0 Cation efflux family protein (.1) Lus10023439 [exp] 81 / 3e-19 AT2G39450 585 / 0.0 Cation efflux family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G010300 [exp] 129 / 2e-37 AT3G58060 479 / 4e-169 Cation efflux family protein (.1) Potri.003G215600 [exp] 127 / 7e-37 AT3G58060 521 / 0.0 Cation efflux family protein (.1) Potri.001G010200 [exp] 125 / 5e-36 AT3G58060 540 / 0.0 Cation efflux family protein (.1) Potri.001G010000 [exp] 122 / 6e-35 AT3G58060 529 / 0.0 Cation efflux family protein (.1) Potri.010G172700 [exp] 94 / 4e-24 AT1G16310 545 / 0.0 Cation efflux family protein (.1) Potri.010G172800 [exp] 92 / 2e-23 AT1G16310 585 / 0.0 Cation efflux family protein (.1) Potri.010G211300 [exp] 91 / 5e-23 AT2G39450 598 / 0.0 Cation efflux family protein (.1) Potri.008G083600 [exp] 91 / 5e-23 AT1G16310 521 / 0.0 Cation efflux family protein (.1) Potri.010G172900 [exp] 90 / 1e-22 AT1G16310 572 / 0.0 Cation efflux family protein (.1) Potri.008G049600 [exp] 86 / 2e-21 AT2G39450 595 / 0.0 Cation efflux family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01545 [flax] [poplar] Cation_efflux Cation efflux family
Representative CDS sequence Show only first row Show all	>Lus10016242 pacid=23142666 polypeptide=Lus10016242 locus=Lus10016242.g ID=Lus10016242.BGIv1.0 annot-version=v1.0 ATGGCATCGACGCAATTGGTTTGGGTGTACGTGTTTATGCTCACAACCACATTCATCAAGCTCGGATTATGGCTCTACTGTAGAAGCTCGGGGAACAAAA TTGTCCGAGCTTATGCAACGTACCACTACTTCGACGTGGTGACAAATGTTGTTGGGCTAGTTGCTGCTGACCTTCATGATGGGTTCTATTGGTGGATCGA TCCGATCGGAGCAATCTTGCTTGCAATCTACACGATTGCAAATGATGTTGGTTCCTGCTATTCATAG
AA sequence Show only first row Show all	>Lus10016242 pacid=23142666 polypeptide=Lus10016242 locus=Lus10016242.g ID=Lus10016242.BGIv1.0 annot-version=v1.0 MASTQLVWVYVFMLTTTFIKLGLWLYCRSSGNKIVRAYATYHYFDVVTNVVGLVAADLHDGFYWWIDPIGAILLAIYTIANDVGSCYS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G58060			Cation efflux family protein (...		Lus10016242 [exp]	0	1

Compare expression of checked genes

Lus10016242 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.