Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02955 64 / 6e-13 MEE12 maternal effect embryo arrest 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021646 [exp] 126 / 4e-35 AT2G02955 442 / 4e-147 maternal effect embryo arrest 12 (.1) Lus10030476 [exp] 116 / 1e-32 AT2G02955 79 / 5e-16 maternal effect embryo arrest 12 (.1) Lus10004454 [exp] 82 / 2e-19 AT2G02955 204 / 8e-60 maternal effect embryo arrest 12 (.1) Lus10034719 [exp] 80 / 9e-19 AT2G02955 370 / 5e-121 maternal effect embryo arrest 12 (.1) Lus10012828 [exp] 75 / 4e-18 AT2G02955 68 / 8e-14 maternal effect embryo arrest 12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G169500 [exp] 105 / 8e-28 AT2G02955 513 / 5e-174 maternal effect embryo arrest 12 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016253 pacid=23142676 polypeptide=Lus10016253 locus=Lus10016253.g ID=Lus10016253.BGIv1.0 annot-version=v1.0 ATGGATTTCGGCGCAGCGGCAACCGGTAAGCTAGGGTATGATGATTACTATACCGAGGTTAGGATTAGGTATGTTTTGGGGATTCAGTATATGTGTCAGA TGCAGTGCGAAGCGTTGGTTGAAGGGTTTGGTGTTAGCCGTTTCATTGTTGGAGTAATGTCTGAAGTTTGGTTGAGTTTTGTGGCTTCAACTGGTGTGTT TAAAGATAGGTGGGATTATGAAACTATGGTGGAATCCGAGTCTCAAACACTTGAAAGAGAAGACACTACCGGAGCAAGCACAAGCACAGTAACGAACCGC ATAATGCATTCGGCGGACGTTTAG
AA sequence Show only first row Show all	>Lus10016253 pacid=23142676 polypeptide=Lus10016253 locus=Lus10016253.g ID=Lus10016253.BGIv1.0 annot-version=v1.0 MDFGAAATGKLGYDDYYTEVRIRYVLGIQYMCQMQCEALVEGFGVSRFIVGVMSEVWLSFVASTGVFKDRWDYETMVESESQTLEREDTTGASTSTVTNR IMHSADV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02955		MEE12	maternal effect embryo arrest ...		Lus10016253 [exp]	0	1
AT2G02955		MEE12	maternal effect embryo arrest ...		Lus10016251 [exp]	12.5	0.6622
AT4G20140		GSO1	GASSHO1, Leucine-rich repeat t...		Lus10016324 [exp]	23.6	0.6992
AT3G03210			unknown protein		Lus10020802 [exp]	91.4	0.6259
AT5G01700			Protein phosphatase 2C family ...		Lus10001268 [exp]	201.9	0.5564

Compare expression of checked genes

Lus10016253 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.