Lus10016266 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G06760 65 / 2e-14 AtLEA4-5, LEA4-5 Late Embryogenesis Abundant 4-5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012009 135 / 4e-43 AT5G06760 71 / 9e-17 Late Embryogenesis Abundant 4-5 (.1)
Lus10021044 90 / 4e-23 AT5G06760 87 / 8e-21 Late Embryogenesis Abundant 4-5 (.1)
Lus10016273 85 / 3e-22 AT5G06760 120 / 3e-35 Late Embryogenesis Abundant 4-5 (.1)
Lus10012018 81 / 1e-20 AT5G06760 123 / 3e-36 Late Embryogenesis Abundant 4-5 (.1)
Lus10004182 76 / 2e-18 AT5G06760 87 / 1e-21 Late Embryogenesis Abundant 4-5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G046350 59 / 3e-12 AT5G06760 101 / 2e-27 Late Embryogenesis Abundant 4-5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03760 LEA_1 Late embryogenesis abundant (LEA) group 1
Representative CDS sequence
>Lus10016266 pacid=23142699 polypeptide=Lus10016266 locus=Lus10016266.g ID=Lus10016266.BGIv1.0 annot-version=v1.0
ATGCAGCCCGTGAAGGAAACCGCTTCCAACATCGCCGCCTCCGCCAAGTCCGGCATGGACAAGACCAAAGCCGTCGCCCAGGAACAGGTGGACAAGGCAT
CGGCCCATGGCGCGATGGGGAAAGAGATGGCGAGGGAGAAGAAGGACGCGAGGGTGGGCGAGGCGGAGGCGACGAAGCGCGAGGCCAAGATGCAGAATGC
GGCGGCGAGGCAAGGTGAGCAGGTGACGGGCGGGTACGGTAACTACACCACTGGTGGAGGACAGACTGGTTATAACCATCAGATATGA
AA sequence
>Lus10016266 pacid=23142699 polypeptide=Lus10016266 locus=Lus10016266.g ID=Lus10016266.BGIv1.0 annot-version=v1.0
MQPVKETASNIAASAKSGMDKTKAVAQEQVDKASAHGAMGKEMAREKKDARVGEAEATKREAKMQNAAARQGEQVTGGYGNYTTGGGQTGYNHQI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G06760 AtLEA4-5, LEA4-... Late Embryogenesis Abundant 4-... Lus10016266 0 1
AT2G26850 F-box family protein (.1) Lus10036444 2.4 0.7982
Lus10028027 4.1 0.8149
AT5G55050 GDSL-like Lipase/Acylhydrolase... Lus10021542 4.6 0.7698
AT5G52605 Defensin-like (DEFL) family pr... Lus10031095 10.4 0.7313
AT1G21000 PLATZ transcription factor fam... Lus10005350 11.6 0.7313
Lus10035508 12.7 0.7313
AT5G56670 Ribosomal protein S30 family p... Lus10019054 13.7 0.7313
AT3G18040 ATMPK9 MAP kinase 9 (.1.2) Lus10038956 14.7 0.7313
Lus10012269 15.6 0.7313
AT5G04347 Plant self-incompatibility pro... Lus10029375 16.4 0.7313

Lus10016266 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.