Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06760 65 / 2e-14 AtLEA4-5, LEA4-5 Late Embryogenesis Abundant 4-5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012009 [exp] 135 / 4e-43 AT5G06760 71 / 9e-17 Late Embryogenesis Abundant 4-5 (.1) Lus10021044 [exp] 90 / 4e-23 AT5G06760 87 / 8e-21 Late Embryogenesis Abundant 4-5 (.1) Lus10016273 [exp] 85 / 3e-22 AT5G06760 120 / 3e-35 Late Embryogenesis Abundant 4-5 (.1) Lus10012018 [exp] 81 / 1e-20 AT5G06760 123 / 3e-36 Late Embryogenesis Abundant 4-5 (.1) Lus10004182 [exp] 76 / 2e-18 AT5G06760 87 / 1e-21 Late Embryogenesis Abundant 4-5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G046350 [exp] 59 / 3e-12 AT5G06760 101 / 2e-27 Late Embryogenesis Abundant 4-5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03760 [flax] [poplar] LEA_1 Late embryogenesis abundant (LEA) group 1
Representative CDS sequence Show only first row Show all	>Lus10016266 pacid=23142699 polypeptide=Lus10016266 locus=Lus10016266.g ID=Lus10016266.BGIv1.0 annot-version=v1.0 ATGCAGCCCGTGAAGGAAACCGCTTCCAACATCGCCGCCTCCGCCAAGTCCGGCATGGACAAGACCAAAGCCGTCGCCCAGGAACAGGTGGACAAGGCAT CGGCCCATGGCGCGATGGGGAAAGAGATGGCGAGGGAGAAGAAGGACGCGAGGGTGGGCGAGGCGGAGGCGACGAAGCGCGAGGCCAAGATGCAGAATGC GGCGGCGAGGCAAGGTGAGCAGGTGACGGGCGGGTACGGTAACTACACCACTGGTGGAGGACAGACTGGTTATAACCATCAGATATGA
AA sequence Show only first row Show all	>Lus10016266 pacid=23142699 polypeptide=Lus10016266 locus=Lus10016266.g ID=Lus10016266.BGIv1.0 annot-version=v1.0 MQPVKETASNIAASAKSGMDKTKAVAQEQVDKASAHGAMGKEMAREKKDARVGEAEATKREAKMQNAAARQGEQVTGGYGNYTTGGGQTGYNHQI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G06760		AtLEA4-5, LEA4-...	Late Embryogenesis Abundant 4-...		Lus10016266 [exp]	0	1
AT2G26850			F-box family protein (.1)		Lus10036444 [exp]	2.4	0.7982
					Lus10028027 [exp]	4.1	0.8149
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10021542 [exp]	4.6	0.7698
AT5G52605			Defensin-like (DEFL) family pr...		Lus10031095 [exp]	10.4	0.7313
AT1G21000			PLATZ transcription factor fam...		Lus10005350 [exp]	11.6	0.7313
					Lus10035508 [exp]	12.7	0.7313
AT5G56670			Ribosomal protein S30 family p...		Lus10019054 [exp]	13.7	0.7313
AT3G18040		ATMPK9	MAP kinase 9 (.1.2)		Lus10038956 [exp]	14.7	0.7313
					Lus10012269 [exp]	15.6	0.7313
AT5G04347			Plant self-incompatibility pro...		Lus10029375 [exp]	16.4	0.7313

Compare expression of checked genes

Lus10016266 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.