Lus10016278 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G42210 216 / 1e-72 ATOEP16-3 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1.2.3.4)
AT3G57900 44 / 2e-06 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012024 283 / 2e-99 AT2G42210 248 / 1e-85 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1.2.3.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G059300 223 / 6e-76 AT2G42210 218 / 1e-73 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02466 Tim17 Tim17/Tim22/Tim23/Pmp24 family
Representative CDS sequence
>Lus10016278 pacid=23142740 polypeptide=Lus10016278 locus=Lus10016278.g ID=Lus10016278.BGIv1.0 annot-version=v1.0
ATGGATTCATCAGAGATGAGGTATTTGGAGGATGATATCACTCCAACCATGAAAACTTTGAAGGGTGCGACCATGGGATTAGTTACTGGAACTATTTGGG
GTACCATTGTTGCCACTTGGCATGATGTGCCTCGTGTTGAGAAGCATGTCGCTCTCCCAGGGCTGATAAGGACCCTGAAGATGATGGGCAGTTACGGCTC
AACATTTGCTGCTATTGGAGGTATTTACATTGGTGTTGAGCAGCTGCTGGAGCAGCAAAGAGCTAAGAGAGATTTCGTTAATGGAGCTGTTGGTGGTTTT
GTCGCTGGGGCTTCTGTTCTAGGCTTGAGAGCAAGGAGCATCCCAACAGCTATTTCTGCAGGAGCAGCACTGGCTGTTACCTCGGCCCTCATTGATGCCG
GAGGCCAGACCACAAGAGTAGACACCGGCAAGGAGTACTACCCTTACACCACCAAGAAGAGATCCACCGTCGATGCATAG
AA sequence
>Lus10016278 pacid=23142740 polypeptide=Lus10016278 locus=Lus10016278.g ID=Lus10016278.BGIv1.0 annot-version=v1.0
MDSSEMRYLEDDITPTMKTLKGATMGLVTGTIWGTIVATWHDVPRVEKHVALPGLIRTLKMMGSYGSTFAAIGGIYIGVEQLLEQQRAKRDFVNGAVGGF
VAGASVLGLRARSIPTAISAGAALAVTSALIDAGGQTTRVDTGKEYYPYTTKKRSTVDA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G42210 ATOEP16-3 Mitochondrial import inner mem... Lus10016278 0 1
AT3G47810 ATVPS29, MAG1 VACUOLAR PROTEIN SORTING 29, M... Lus10030497 1.0 0.9476
AT3G03100 NADH:ubiquinone oxidoreductase... Lus10030358 2.0 0.9175
AT5G52840 NADH-ubiquinone oxidoreductase... Lus10039296 3.5 0.9168
AT1G26690 emp24/gp25L/p24 family/GOLD fa... Lus10036786 3.7 0.8910
AT5G58710 ROC7 rotamase CYP 7 (.1) Lus10040666 4.9 0.9132
AT3G22110 PAC1 20S proteasome alpha subunit C... Lus10004236 4.9 0.8958
AT4G21105 cytochrome-c oxidases;electron... Lus10006276 6.2 0.8619
AT3G20920 translocation protein-related ... Lus10030136 6.5 0.9035
AT4G34700 CIB22, AtCIB22 B22 subunit of eukaryotic mito... Lus10018052 6.8 0.8754
AT2G27510 ATFD3 ferredoxin 3 (.1) Lus10034144 8.8 0.9047

Lus10016278 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.