Lus10016308 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010796 48 / 5e-08 AT4G19020 790 / 0.0 chromomethylase 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G100000 40 / 1e-05 AT4G19020 1017 / 0.0 chromomethylase 2 (.1)
PFAM info
Representative CDS sequence
>Lus10016308 pacid=23145874 polypeptide=Lus10016308 locus=Lus10016308.g ID=Lus10016308.BGIv1.0 annot-version=v1.0
ATGGGAAATACAGTTGCTGTCCCAGTGGGTCGAGCATTGGGATATGCGAAGGGACTGGCAGCTCTGGGACTTAGCGATGATAAACCACTCATGACTCTTC
CCAAAAAGTTCTCACATTCAACTAATCTTCAACTACAGGAGCAAGAGCAGCAGCAGCAGCAGCTTGAAACAGTTAACAAAACTAGTTACGATTGA
AA sequence
>Lus10016308 pacid=23145874 polypeptide=Lus10016308 locus=Lus10016308.g ID=Lus10016308.BGIv1.0 annot-version=v1.0
MGNTVAVPVGRALGYAKGLAALGLSDDKPLMTLPKKFSHSTNLQLQEQEQQQQQLETVNKTSYD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G19020 CMT2 chromomethylase 2 (.1) Lus10016308 0 1
AT3G22142 Bifunctional inhibitor/lipid-t... Lus10040741 6.9 0.7274
AT2G19480 NFA2, NFA02, NA... NUCLEOSOME/CHROMATIN ASSEMBLY ... Lus10005551 10.4 0.8187
AT2G33530 SCPL46 serine carboxypeptidase-like 4... Lus10040326 20.6 0.7973
Lus10034718 22.8 0.7840
AT1G29670 GDSL-like Lipase/Acylhydrolase... Lus10002775 23.4 0.7897
AT1G49490 Leucine-rich repeat (LRR) fami... Lus10027935 31.0 0.7860
AT4G38830 CRK26 cysteine-rich RLK (RECEPTOR-li... Lus10002371 32.6 0.7763
AT5G03610 GDSL-like Lipase/Acylhydrolase... Lus10042849 36.1 0.7682
AT1G80730 C2H2ZnF ATZFP1, ZFP1 ARABIDOPSIS THALIANA ZINC-FING... Lus10019536 38.5 0.7801
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10029333 45.2 0.7627

Lus10016308 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.