Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47960 115 / 2e-32 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1) AT3G17140 57 / 8e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46930 58 / 9e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46970 56 / 6e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17130 55 / 2e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17150 54 / 4e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46940 48 / 4e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17152 48 / 4e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G64620 45 / 4e-06 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1) AT5G46960 44 / 1e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002738 [exp] 154 / 2e-47 AT1G47960 67 / 5e-14 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016318 [exp] 137 / 5e-41 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10000822 [exp] 130 / 3e-38 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10027947 [exp] 127 / 3e-37 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017076 [exp] 123 / 1e-35 AT1G47960 88 / 9e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017013 [exp] 122 / 4e-35 AT1G47960 112 / 4e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10037792 [exp] 118 / 1e-33 AT1G47960 91 / 1e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017040 [exp] 102 / 1e-27 AT1G47960 92 / 3e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10002933 [exp] 84 / 1e-20 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G063000 [exp] 133 / 1e-39 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.009G083500 [exp] 104 / 2e-28 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.008G102600 [exp] 76 / 2e-17 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.010G209800 [exp] 57 / 3e-10 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.001G288500 [exp] 54 / 7e-10 AT1G47960 59 / 1e-11 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.007G108301 [exp] 49 / 3e-07 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.005G023201 [exp] 48 / 1e-06 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023100 [exp] 48 / 1e-06 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.006G134900 [exp] 44 / 2e-05 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.005G023050 [exp] 44 / 3e-05 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10016317 pacid=23161890 polypeptide=Lus10016317 locus=Lus10016317.g ID=Lus10016317.BGIv1.0 annot-version=v1.0 ATGGCGCCAAATCCCACTGCCCCACCTCTCACAAACCTCGCCAACCTCGCCGCCTTCTTCCTCCTCCCCATCCTCCTCAATTCCGCCGCCGAAGCTTCTT TAATCGCTGACACCTGCAAGCAAACCCCGAACTACGACCTCTGCCTATCCTCAATCGCCGCCGACCCACGCGGCTCCAAAGCCGCCGACATCGAAACACT AGCCCTCGTGATGATCGACACCGTCAAGTCGAAGGCGACGGCGGCGTCCAATCGCATCCAGCAGCTGATGAAAACTTCCCCGGCCGCGATGAGGAAGCCG CTCAGAGCTTGTGCCGAAGTTTATGACATCATTATTAACTACGAAATCCCGGAGGCCTTGCAAGCGGTGCGTTTGGGGGATCCGAAATTCGGGGAGGACG CGATGAATGACTCCGCTGCCGAGCCCGCTTCCTGCGAAGGCGGGTTCGGCGGGGAGAGCAGGGCGGCGCCGATTTCCCNNNNNNNNNNNNNNNNNGCGCC CCGCCAGGCCCTTCGCGGCGCCGCCGCCGTGACGGCGGCGATCATAAGGCTGTTGCTTTGA
AA sequence Show only first row Show all	>Lus10016317 pacid=23161890 polypeptide=Lus10016317 locus=Lus10016317.g ID=Lus10016317.BGIv1.0 annot-version=v1.0 MAPNPTAPPLTNLANLAAFFLLPILLNSAAEASLIADTCKQTPNYDLCLSSIAADPRGSKAADIETLALVMIDTVKSKATAASNRIQQLMKTSPAAMRKP LRACAEVYDIIINYEIPEALQAVRLGDPKFGEDAMNDSAAEPASCEGGFGGESRAAPISXXXXXXAPRQALRGAAAVTAAIIRLLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10016317 [exp]	0	1
AT4G17250			unknown protein		Lus10008508 [exp]	1.0	0.9059
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10002738 [exp]	1.4	0.9055
AT4G31500		SUR2, RNT1, RED...	SUPERROOT 2, RUNT 1, RED ELONG...		Lus10012399 [exp]	2.0	0.8295
AT1G52240		PIRF1, ATROPGEF...	phytochrome interacting RopGEF...		Lus10025794 [exp]	5.5	0.7881
AT3G57540			Remorin family protein (.1)		Lus10042367 [exp]	5.9	0.8292
AT5G43280		ATDCI1	"delta\(3,5\),delta\(2,4\)-die...		Lus10002583 [exp]	6.2	0.8525
AT4G32680			unknown protein		Lus10035889 [exp]	7.5	0.7896
AT1G17750		AtPEPR2	PEP1 receptor 2 (.1)		Lus10032945 [exp]	8.0	0.7667
AT5G42850			Thioredoxin superfamily protei...		Lus10037477 [exp]	8.9	0.8044
AT2G30330		BLOS1	BLOC subunit 1, GCN5L1 family ...		Lus10030147 [exp]	12.0	0.8022

Compare expression of checked genes

Lus10016317 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.