Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47960 115 / 2e-32 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1) AT3G17140 66 / 4e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46940 60 / 2e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G64620 57 / 1e-10 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1) AT3G17130 57 / 3e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17150 53 / 7e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46970 49 / 1e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17152 49 / 2e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46950 46 / 2e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46960 45 / 4e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017013 [exp] 220 / 6e-74 AT1G47960 112 / 4e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017040 [exp] 188 / 2e-61 AT1G47960 92 / 3e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016317 [exp] 138 / 2e-41 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10027947 [exp] 137 / 5e-41 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10000822 [exp] 135 / 3e-40 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017076 [exp] 108 / 6e-30 AT1G47960 88 / 9e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10021338 [exp] 105 / 8e-30 AT1G47960 59 / 3e-12 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10037792 [exp] 103 / 6e-28 AT1G47960 91 / 1e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017014 [exp] 87 / 8e-23 AT1G47960 56 / 4e-11 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G063000 [exp] 127 / 1e-37 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.009G083500 [exp] 96 / 3e-25 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.008G102600 [exp] 75 / 4e-17 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.006G134900 [exp] 66 / 2e-13 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.010G209800 [exp] 62 / 2e-12 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.007G108301 [exp] 54 / 4e-09 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.003G122000 [exp] 47 / 1e-06 AT5G64620 53 / 7e-09 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.007G068300 [exp] 45 / 4e-06 AT4G00872 113 / 4e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G109700 [exp] 43 / 3e-05 AT1G47960 46 / 2e-06 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.016G001600 [exp] 40 / 0.0002 AT5G64620 82 / 9e-20 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10016318 pacid=23161886 polypeptide=Lus10016318 locus=Lus10016318.g ID=Lus10016318.BGIv1.0 annot-version=v1.0 ATGGCAACATTCACAGCCAAACTCGCTACCCTAACCTCCGTTTTCCTCCTCCTCGTCATCCTCCTATCCCATAACATAACCGCAGACAAGGACCTCATCA TAGGAACTTGCAAGCAAACACCATACTTCAAACTCTGCGTCACCACGCTCATCTCTGACCCTCGGGGCCCGGAGGCCAACGACGTGAAGTCGCTGGCCTT GGTGTTAGTCGACGCCGTACAGACGAAAGGGACGGTGGTTTACAAGGAGGTGGAGAAGTTGCTGGTGACGAACCCGGAGTTGAAGAAGCCGCTCGAGGAA TGCGCCGAGGGCTACTATTTTGTGGTACACGAAGACCACGACGAGGCGGTGGAAGCGGTGAGTAAAGGGGACCCCAAATTTGGAGAGGACGTCATGAGCG ACTCTCAGGGCGAGCCTGAGAGCTGCGAGGATTCGTTCAAACAATACGGGAAGAAGTCTCCGTTGACTCAGCTCAACTCTGCTGTTTATGAGATCGCCGG CGTGGCCAGAGCCGTTATCCGTTTGCTGGAATGA
AA sequence Show only first row Show all	>Lus10016318 pacid=23161886 polypeptide=Lus10016318 locus=Lus10016318.g ID=Lus10016318.BGIv1.0 annot-version=v1.0 MATFTAKLATLTSVFLLLVILLSHNITADKDLIIGTCKQTPYFKLCVTTLISDPRGPEANDVKSLALVLVDAVQTKGTVVYKEVEKLLVTNPELKKPLEE CAEGYYFVVHEDHDEAVEAVSKGDPKFGEDVMSDSQGEPESCEDSFKQYGKKSPLTQLNSAVYEIAGVARAVIRLLE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10016318 [exp]	0	1
AT1G49230			RING/U-box superfamily protein...		Lus10020859 [exp]	13.1	0.8768
AT2G02360		ATPP2-B10	phloem protein 2-B10 (.1)		Lus10003444 [exp]	15.2	0.8701
AT1G06330			Heavy metal transport/detoxifi...		Lus10020704 [exp]	16.3	0.8687
AT1G26820		RNS3	ribonuclease 3 (.1)		Lus10003110 [exp]	26.7	0.8076
AT2G24280			alpha/beta-Hydrolases superfam...		Lus10017002 [exp]	30.5	0.8540
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10000993 [exp]	31.2	0.8391
AT5G10130			Pollen Ole e 1 allergen and ex...		Lus10026040 [exp]	35.1	0.8547
AT2G43870			Pectin lyase-like superfamily ...		Lus10002126 [exp]	40.1	0.8297
AT2G24280			alpha/beta-Hydrolases superfam...		Lus10021325 [exp]	43.1	0.7906
AT4G35680			Arabidopsis protein of unknown...		Lus10041833 [exp]	49.1	0.7936

Compare expression of checked genes

Lus10016318 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.