Lus10016319 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G17130 120 / 2e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G47960 45 / 5e-06 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002739 241 / 6e-82 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10037791 167 / 6e-53 AT3G17130 131 / 8e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10017074 154 / 2e-47 AT3G17130 121 / 8e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10002933 56 / 6e-10 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10003530 55 / 2e-09 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016317 52 / 3e-08 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10027947 46 / 3e-06 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016318 45 / 7e-06 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10000822 43 / 4e-05 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G102600 139 / 5e-42 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.009G083500 63 / 2e-12 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.010G063000 61 / 1e-11 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10016319 pacid=23161793 polypeptide=Lus10016319 locus=Lus10016319.g ID=Lus10016319.BGIv1.0 annot-version=v1.0
ATGACAATAATCTCCTCAGTTTCTCTTCTCCTAATCCTAATCCTAATCCTCATCCCATCCGCCGTCAAATCCGACGACCTAATCGAACAAGTCTGCAAAA
AAACCCCCTTCTACGGCCTCTGCGCCGCCACTCTCCACTCCAACTCCTCGTCCTCTGCATCCTCCGACATCAAGGGCCTCGCCTCGTCAGCAACCAACCT
CGTACTCTCCAACGCCACGGAGACGCTGGCTTACATCCAGCAGCAGTTAAAGCAAACCAGGGATCCCAAGCTGGAGAAAGCTCTGGCGAATTGCGCGGAG
CTCTACATTCCGGTGGTGAAGTACAATCTCCCCCAGGCAATGGACGCTTTCCTCAGGGGGTATTACGGGTTTACCAAGTACGCGCTCTCCGACGCGAGTA
AGCAGGCTGATGCTTGCCAGAAGAGCTTGTCCGGCGCCGGCGCGGGGTCCGGCGCCGGGGCTTCCGGCGCGGGAGGGGAGTTGGGGGCGAGGAATAAGTT
GTTGAGTGATTTGTGTGATGTAGGGGCCGCCATTGTTGGGTTGCTAATGAAAGTTGGGGGTTTAAAGGTTTGA
AA sequence
>Lus10016319 pacid=23161793 polypeptide=Lus10016319 locus=Lus10016319.g ID=Lus10016319.BGIv1.0 annot-version=v1.0
MTIISSVSLLLILILILIPSAVKSDDLIEQVCKKTPFYGLCAATLHSNSSSSASSDIKGLASSATNLVLSNATETLAYIQQQLKQTRDPKLEKALANCAE
LYIPVVKYNLPQAMDAFLRGYYGFTKYALSDASKQADACQKSLSGAGAGSGAGASGAGGELGARNKLLSDLCDVGAAIVGLLMKVGGLKV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G17130 Plant invertase/pectin methyle... Lus10016319 0 1
AT3G17130 Plant invertase/pectin methyle... Lus10002739 1.0 0.9612
AT5G25190 AP2_ERF ESE3 ethylene and salt inducible 3,... Lus10035859 2.6 0.8574
AT4G05400 copper ion binding (.1.2) Lus10008331 5.7 0.8887
AT3G13160 Tetratricopeptide repeat (TPR)... Lus10007620 9.3 0.8769
AT2G16600 ROC3 rotamase CYP 3 (.1.2) Lus10007579 11.3 0.8719
AT3G55605 Mitochondrial glycoprotein fam... Lus10001015 13.4 0.8220
AT2G40940 ERS1 ethylene response sensor 1 (.1... Lus10013415 19.4 0.8129
AT1G15140 FAD/NAD(P)-binding oxidoreduct... Lus10034633 20.2 0.8258
AT5G09590 HSC70-5, mtHSC7... HEAT SHOCK COGNATE, mitochondr... Lus10009039 20.6 0.8585
AT5G09590 HSC70-5, mtHSC7... HEAT SHOCK COGNATE, mitochondr... Lus10009677 20.8 0.8485

Lus10016319 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.