Lus10016322 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017013 55 / 7e-10 AT1G47960 112 / 4e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016318 0 / 1 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017040 0 / 1 AT1G47960 92 / 3e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10016322 pacid=23161895 polypeptide=Lus10016322 locus=Lus10016322.g ID=Lus10016322.BGIv1.0 annot-version=v1.0
ATGGCGGAATTGGGGTCGGCCCAATCCAAACTATCGTCCAGGTCCCTCGTCTCAAAGCGTGGAAAATATCGATGCTCTCAGGCTCAAGTTGAGAGTCGGC
CATGGCGTCCTCTCCAAATTTGGGCTGCCCTTTACTCACCGCTTCCACCACCTCGTCGTGGTCGCCGTGTACCACATAATCGTAACCCTCGGCGCGGCTT
CTTCGACTCCGGGTTCGTCACCAGCAATTCCTTTATCTCTTTCGAAATCACCAGCCCTTTCGCCTGCACGGCGTCGATCAAAACCAAGGCCAGCGACGTG
ACGTCGTTGGCCCTTCAAGCCGCGAGGGTCGGCGATGAGAGCCGACACGCAGACTTTGAAGTATGGGGTTTGCTGGCAAACATCTTCGATGAAGACCTTG
TTCGCAGTCGATGGTGA
AA sequence
>Lus10016322 pacid=23161895 polypeptide=Lus10016322 locus=Lus10016322.g ID=Lus10016322.BGIv1.0 annot-version=v1.0
MAELGSAQSKLSSRSLVSKRGKYRCSQAQVESRPWRPLQIWAALYSPLPPPRRGRRVPHNRNPRRGFFDSGFVTSNSFISFEITSPFACTASIKTKASDV
TSLALQAARVGDESRHADFEVWGLLANIFDEDLVRSRW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10016322 0 1
Lus10000359 2.4 0.8586
AT1G11040 HSP40/DnaJ peptide-binding pro... Lus10042725 5.7 0.8833
AT4G26220 S-adenosyl-L-methionine-depend... Lus10009484 9.4 0.8190
AT2G39550 GGB, ATGGT-IB, ... GERANYLGERANYLTRANSFERASE-I BE... Lus10019318 16.0 0.7685
AT2G41510 ATCKX1, CKX1 cytokinin oxidase/dehydrogenas... Lus10042035 17.2 0.8334
AT3G02840 ARM repeat superfamily protein... Lus10021822 18.1 0.7923
AT4G35530 phosphatidylinositolglycan-rel... Lus10002922 22.6 0.8203
AT5G63080 2-oxoglutarate (2OG) and Fe(II... Lus10001249 22.8 0.8504
AT3G55005 TON1B tonneau 1b (TON1b) (.1) Lus10023478 32.6 0.8290
Lus10031302 44.5 0.8113

Lus10016322 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.