Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48485 62 / 8e-14 DIR1 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G48490 61 / 2e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G55460 44 / 8e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G55450 44 / 1e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G55410 40 / 2e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002741 [exp] 141 / 4e-45 AT5G48490 74 / 3e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039511 [exp] 90 / 6e-25 AT5G48485 80 / 4e-21 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10038233 [exp] 72 / 2e-17 AT5G48490 78 / 5e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10025866 [exp] 72 / 2e-17 AT5G48490 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10016582 [exp] 49 / 1e-08 AT5G55410 81 / 2e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10032575 [exp] 40 / 3e-05 AT5G55410 73 / 2e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G149900 [exp] 91 / 6e-25 AT5G48485 77 / 1e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G251000 [exp] 72 / 1e-17 AT5G48485 76 / 2e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G112553 [exp] 46 / 2e-07 AT5G48485 62 / 1e-13 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.T125404 [exp] 45 / 2e-07 AT5G48485 62 / 1e-13 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016323 pacid=23161850 polypeptide=Lus10016323 locus=Lus10016323.g ID=Lus10016323.BGIv1.0 annot-version=v1.0 ATGGCTAGAGTTGAAGTTGGAAGGATGCTGATGTTATGGGTGGTGGTGGTGGTGTTGTTGTGTGTGGTGCAAGAAAGCAGTGGTCAGACGATATGCAACA TACCGATAGCAGGGCTAAGGGCTTGCAAGCCATCGGTGACTCCCCCGAGGCCACCGAGGCCTACTGCCGACTGCTGTCGAGCCATCTCGCATGCCGATAT GAAATGCATTTGCTCCTACAAGAACTCTCCTTTGCTCCCTTCCCTTGGCATCAGTGTCCCTCTTGCCCAGCAGCTCCCTGTCAAGTGCAGGCTCTCCACT GCTGCCAAATGCTAG
AA sequence Show only first row Show all	>Lus10016323 pacid=23161850 polypeptide=Lus10016323 locus=Lus10016323.g ID=Lus10016323.BGIv1.0 annot-version=v1.0 MARVEVGRMLMLWVVVVVLLCVVQESSGQTICNIPIAGLRACKPSVTPPRPPRPTADCCRAISHADMKCICSYKNSPLLPSLGISVPLAQQLPVKCRLST AAKC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G48490			Bifunctional inhibitor/lipid-t...		Lus10016323 [exp]	0	1
AT1G28480		roxy19, GRX480	Thioredoxin superfamily protei...		Lus10017693 [exp]	1.0	0.9452
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10000453 [exp]	2.0	0.9325
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Lus10003940 [exp]	3.0	0.9051
AT2G31880		SOBIR1, EVR	SUPPRESSOR OF BIR1 1, EVERSHED...		Lus10013675 [exp]	3.2	0.8732
AT5G48490			Bifunctional inhibitor/lipid-t...		Lus10002741 [exp]	4.7	0.8347
AT5G24130			unknown protein		Lus10039333 [exp]	5.7	0.8488
AT5G48540			receptor-like protein kinase-r...		Lus10038227 [exp]	6.6	0.8992
AT4G10250		ATHSP22.0	HSP20-like chaperones superfam...		Lus10026262 [exp]	7.3	0.8478
AT2G34930			disease resistance family prot...		Lus10016325 [exp]	8.5	0.8340
AT1G33720		CYP76C6	"cytochrome P450, family 76, s...		Lus10006323 [exp]	8.9	0.7985

Compare expression of checked genes

Lus10016323 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.