Lus10016330 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G11765 47 / 2e-07 Plant self-incompatibility protein S1 family (.1)
AT5G04350 44 / 3e-06 Plant self-incompatibility protein S1 family (.1)
AT5G06030 42 / 1e-05 Plant self-incompatibility protein S1 family (.1)
AT5G12060 40 / 7e-05 Plant self-incompatibility protein S1 family (.1)
AT3G26880 38 / 0.0004 Plant self-incompatibility protein S1 family (.1)
AT3G17080 37 / 0.0007 Plant self-incompatibility protein S1 family (.1)
AT4G29035 37 / 0.0008 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002747 121 / 1e-36 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1)
Lus10016329 112 / 7e-33 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1)
Lus10023195 90 / 3e-24 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Lus10023196 82 / 5e-21 AT2G06090 54 / 4e-10 Plant self-incompatibility protein S1 family (.1)
Lus10002219 77 / 3e-19 AT1G04645 40 / 2e-05 Plant self-incompatibility protein S1 family (.1)
Lus10023194 76 / 2e-18 AT2G06090 49 / 3e-08 Plant self-incompatibility protein S1 family (.1)
Lus10019767 72 / 5e-17 AT4G29035 50 / 1e-08 Plant self-incompatibility protein S1 family (.1)
Lus10023193 69 / 3e-16 ND 37 / 6e-04
Lus10018785 66 / 1e-14 AT4G16295 50 / 1e-08 S-protein homologue 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G252500 47 / 2e-07 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.016G066900 45 / 1e-06 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.010G008300 43 / 6e-06 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.004G199700 40 / 0.0001 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.018G148366 37 / 0.0008 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10016330 pacid=23161909 polypeptide=Lus10016330 locus=Lus10016330.g ID=Lus10016330.BGIv1.0 annot-version=v1.0
ATGTCGTCGTCGCCGTCGGTGGTTACGATATTAGTAGCAGTAACAATTGTTATGGCTGCACGGCAGTCAACTCAGGCGAAGGAGAAGGTCATAATTACCA
ACCAGATGAGCATACCGCTAATAGCGCATTGCCGGTCGGAAGATAATGACATCGCCCCGCAAATCGTTTCGGTTGGGTCGGACTTGAGTTGGAGTTTCTG
GGATGATTTTCTCGTCGACACGACACTCTTCTGGCGCCACCTTGCCGCGCAAGATAAGCGTCTGCGTTTCGATGCGTACGTTAACGATTTAATATGTCCA
GGCACAACCCATTGGGTTGTCAACGATACCGGGGCTTACGACGCTGACAGGGAATCGGTACACCTACGGTAA
AA sequence
>Lus10016330 pacid=23161909 polypeptide=Lus10016330 locus=Lus10016330.g ID=Lus10016330.BGIv1.0 annot-version=v1.0
MSSSPSVVTILVAVTIVMAARQSTQAKEKVIITNQMSIPLIAHCRSEDNDIAPQIVSVGSDLSWSFWDDFLVDTTLFWRHLAAQDKRLRFDAYVNDLICP
GTTHWVVNDTGAYDADRESVHLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G11765 Plant self-incompatibility pro... Lus10016330 0 1

Lus10016330 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.